Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SELL blocking peptide

SELL Peptide - C-terminal region

Gene Names
Sell; Lnhr; CD62L; Ly-22; Lyam1; Ly-m22; Lyam-1; LECAM-1; AI528707; L-selectin
Reactivity
Mouse
Synonyms
SELL; SELL Peptide - C-terminal region; SELL blocking peptide
Ordering
For Research Use Only!
Reactivity
Mouse
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: NWSSPEPICQETNRSFSKIKEGDYNPLFIPVAVMVTAFSGLAFLIWLARR
Sequence Length
372
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for SELL blocking peptide
This is a synthetic peptide designed for use in combination with anti- SELL Antibody, made

Target Description: Calcium-dependent lectin that mediates cell adhesion by binding to glycoproteins on neighboring cells. Mediates the adherence of lymphocytes to endothelial cells of high endothelial venules in peripheral lymph nodes. Promotes initial tethering and rolling of leukocytes in endothelia (By similarity).
Product Categories/Family for SELL blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
40 kDa
NCBI Official Full Name
L-selectin isoform 1
NCBI Official Synonym Full Names
selectin, lymphocyte
NCBI Official Symbol
Sell
NCBI Official Synonym Symbols
Lnhr; CD62L; Ly-22; Lyam1; Ly-m22; Lyam-1; LECAM-1; AI528707; L-selectin
NCBI Protein Information
L-selectin
UniProt Protein Name
L-selectin
Protein Family
UniProt Gene Name
Sell
UniProt Synonym Gene Names
Lnhr; Ly-22; Ly22; LAM-1; LECAM1; Ly-22
UniProt Entry Name
LYAM1_MOUSE

Uniprot Description

SELL: Cell surface adhesion protein. Mediates the adherence of lymphocytes to endothelial cells of high endothelial venules in peripheral lymph nodes. Promotes initial tethering and rolling of leukocytes in endothelia. Belongs to the selectin/LECAM family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral

Cellular Component: cell surface; membrane; integral to membrane; plasma membrane; external side of plasma membrane

Molecular Function: protein binding; protease binding; cell adhesion molecule binding; carbohydrate binding; glycolipid binding

Biological Process: regulation of apoptosis; cell adhesion; response to ATP

Research Articles on SELL

Similar Products

Product Notes

The SELL sell (Catalog #AAA3248155) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The SELL Peptide - C-terminal region reacts with Mouse and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: Synthetic peptide located within the following region: NWSSPEPICQ ETNRSFSKIK EGDYNPLFIP VAVMVTAFSG LAFLIWLARR. It is sometimes possible for the material contained within the vial of "SELL, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.