Western Blot (WB)
(Host: RabbitTarget Name: SELLSample Tissue: Mouse Skeletal Muscle lysatesAntibody Dilution: 1ug/ml)
Rabbit anti-Mouse SELL Polyclonal Antibody | anti-SELL antibody
SELL Antibody - C-terminal region
Gene Names
Sell; Lnhr; CD62L; Ly-22; Lyam1; Ly-m22; Lyam-1; LECAM-1; AI528707; L-selectin
Reactivity
Mouse
Applications
Western Blot
Purity
Affinity purified
Synonyms
SELL; Polyclonal Antibody; SELL Antibody - C-terminal region; anti-SELL antibody
Host
Rabbit
Reactivity
Mouse
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: NWSSPEPICQETNRSFSKIKEGDYNPLFIPVAVMVTAFSGLAFLIWLARR
Sequence Length
372
Applicable Applications for anti-SELL antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of mouse SELL
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: SELLSample Tissue: Mouse Skeletal Muscle lysatesAntibody Dilution: 1ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: SELLSample Tissue: Mouse Skeletal Muscle lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-SELL antibody
Calcium-dependent lectin that mediates cell adhesion by binding to glycoproteins on neighboring cells. Mediates the adherence of lymphocytes to endothelial cells of high endothelial venules in peripheral lymph nodes. Promotes initial tethering and rolling of leukocytes in endothelia (By similarity).
Product Categories/Family for anti-SELL antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
40 kDa
NCBI Official Full Name
L-selectin isoform 1
NCBI Official Synonym Full Names
selectin, lymphocyte
NCBI Official Symbol
Sell
NCBI Official Synonym Symbols
Lnhr; CD62L; Ly-22; Lyam1; Ly-m22; Lyam-1; LECAM-1; AI528707; L-selectin
NCBI Protein Information
L-selectin
UniProt Protein Name
L-selectin
Protein Family
UniProt Gene Name
Sell
UniProt Synonym Gene Names
Lnhr; Ly-22; Ly22; LAM-1; LECAM1; Ly-22
UniProt Entry Name
LYAM1_MOUSE
Uniprot Description
SELL: Cell surface adhesion protein. Mediates the adherence of lymphocytes to endothelial cells of high endothelial venules in peripheral lymph nodes. Promotes initial tethering and rolling of leukocytes in endothelia. Belongs to the selectin/LECAM family. 2 isoforms of the human protein are produced by alternative splicing.
Protein type: Membrane protein, integral
Cellular Component: cell surface; membrane; integral to membrane; plasma membrane; external side of plasma membrane
Molecular Function: protein binding; protease binding; cell adhesion molecule binding; carbohydrate binding; glycolipid binding
Biological Process: regulation of apoptosis; cell adhesion; response to ATP
Research Articles on SELL
Similar Products
Product Notes
The SELL sell (Catalog #AAA3223540) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SELL Antibody - C-terminal region reacts with Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's SELL can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SELL sell for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: NWSSPEPICQ ETNRSFSKIK EGDYNPLFIP VAVMVTAFSG LAFLIWLARR. It is sometimes possible for the material contained within the vial of "SELL, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
