Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

RBPJ blocking peptide

RBPJ Peptide - middle region

Gene Names
Rbpj; CBF1; RBP-J; RBPjk; Igkjrb; Rbpsuh; Igkrsbp; AI843960; RBP-Jkappa; RBP-J kappa
Reactivity
Mouse
Synonyms
RBPJ; RBPJ Peptide - middle region; RBPJ blocking peptide
Ordering
For Research Use Only!
Reactivity
Mouse
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: CVYLMGSGWKKKKEQMERDGCSEQESQPCAFIGIGNSDQEMQQLNLEGKN
Sequence Length
487
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for RBPJ blocking peptide
This is a synthetic peptide designed for use in combination with anti- RBPJ Antibody, made

Target Description: Transcriptional regulator that plays a central role in Notch signaling, a signaling pathway involved in cell-cell communication that regulates a broad spectrum of cell-fate determinations. Acts as a transcriptional repressor when it is not associated with Notch proteins. When associated with some NICD product of Notch proteins (Notch intracellular domain), it acts as a transcriptional activator that activates transcription of Notch target genes. Probably represses or activates transcription via the recruitment of chromatin remodeling complexes containing histone deacetylase or histone acetylase proteins, respectively. Specifically binds to the immunoglobulin kappa-type J segment recombination signal sequence. Binds specifically to methylated DNA. Binds to the oxygen responsive element of COX4I2 and activates its transcription under hypoxia conditions (4% oxygen) (By similarity). Negatively regulates the phagocyte oxidative burst in response to bacterial infection by repressing transcription of NADPH oxidase subunits.
Product Categories/Family for RBPJ blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
53 kDa
NCBI Official Full Name
recombining binding protein suppressor of hairless isoform 2
NCBI Official Synonym Full Names
recombination signal binding protein for immunoglobulin kappa J region
NCBI Official Symbol
Rbpj
NCBI Official Synonym Symbols
CBF1; RBP-J; RBPjk; Igkjrb; Rbpsuh; Igkrsbp; AI843960; RBP-Jkappa; RBP-J kappa
NCBI Protein Information
recombining binding protein suppressor of hairless
UniProt Protein Name
Recombining binding protein suppressor of hairless
UniProt Gene Name
Rbpj
UniProt Synonym Gene Names
Igkjrb1; Igkrsbp; Rbpsuh
UniProt Entry Name
SUH_MOUSE

Research Articles on RBPJ

Similar Products

Product Notes

The RBPJ rbpj (Catalog #AAA3248252) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The RBPJ Peptide - middle region reacts with Mouse and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: Synthetic peptide located within the following region: CVYLMGSGWK KKKEQMERDG CSEQESQPCA FIGIGNSDQE MQQLNLEGKN. It is sometimes possible for the material contained within the vial of "RBPJ, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.