Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

H2-D1 blocking peptide

H2-D1 Peptide-middle region

Gene Names
H2-D1; H-2D; H2-D
Reactivity
Mouse
Synonyms
H2-D1; H2-D1 Peptide-middle region; H-2D; H2-D; H2-K1; H2-D1 blocking peptide
Ordering
For Research Use Only!
Reactivity
Mouse
Form/Format
Lyophilized powder
Sequence
PLGKEQKYTCHVEHEGLPEPLTLRWGKEEPPSSTKTNTVIIAVPVVLGAV
Quality Control
The peptide is characterized by mass spectroscopy
Protein Size
298 amino acids
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for H2-D1 blocking peptide
This is a synthetic peptide designed for use in combination with anti-H2-D1 Antibody. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Description of Target: Involved in the presentation of foreign antigens to the immune system.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
32,472 Da
NCBI Official Full Name
H-2 class I histocompatibility antigen, alpha chain
NCBI Official Synonym Full Names
histocompatibility 2, D region locus 1
NCBI Official Symbol
H2-D1
NCBI Official Synonym Symbols
H-2D; H2-D
NCBI Protein Information
H-2 class I histocompatibility antigen, D-B alpha chain
UniProt Protein Name
H-2 class I histocompatibility antigen, alpha chain
UniProt Gene Name
H2-D1

Uniprot Description

Involved in the presentation of foreign antigens to the immune system.

Research Articles on H2-D1

Similar Products

Product Notes

The H2-D1 h2-d1 (Catalog #AAA3249568) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The H2-D1 Peptide-middle region reacts with Mouse and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: PLGKEQKYTC HVEHEGLPEP LTLRWGKEEP PSSTKTNTVI IAVPVVLGAV. It is sometimes possible for the material contained within the vial of "H2-D1, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.