Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

FCGRT blocking peptide

FCGRT Peptide - middle region

Gene Names
Fcgrt; FcRn
Reactivity
Mouse
Synonyms
FCGRT; FCGRT Peptide - middle region; FCGRT blocking peptide
Ordering
For Research Use Only!
Reactivity
Mouse
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: DPCGAWMWENQVSWYWEKETTDLKSKEQLFLEALKTLEKILNGTYTLQGL
Sequence Length
365
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for FCGRT blocking peptide
This is a synthetic peptide designed for use in combination with anti- FCGRT Antibody, made

Target Description: Binds to the Fc region of monomeric immunoglobulins gamma. Mediates the selective uptake of IgG from milk and helps newborn animals to acquire passive immunity. IgG in the milk is bound at the apical surface of the intestinal epithelium. The resultant FcRn-IgG complexes are transcytosed across the intestinal epithelium and IgG is released from FcRn into blood or tissue fluids (By similarity). Possible role in transfer of immunoglobulin G from mother to fetus (By similarity).
Product Categories/Family for FCGRT blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
40 kDa
NCBI Official Full Name
IgG receptor FcRn large subunit p51 isoform 1
NCBI Official Synonym Full Names
Fc receptor, IgG, alpha chain transporter
NCBI Official Symbol
Fcgrt
NCBI Official Synonym Symbols
FcRn
NCBI Protein Information
IgG receptor FcRn large subunit p51
UniProt Protein Name
IgG receptor FcRn large subunit p51
Protein Family
UniProt Gene Name
Fcgrt
UniProt Synonym Gene Names
Fcrn; FcRn
UniProt Entry Name
FCGRN_MOUSE

Uniprot Description

FCGRT: Binds to the Fc region of monomeric immunoglobulins gamma. Mediates the uptake of IgG from milk. Possible role in transfer of immunoglobulin G from mother to fetus. Belongs to the immunoglobulin superfamily.

Protein type: Immunoglobulin superfamily; Receptor, misc.; Membrane protein, integral

Cellular Component: membrane; plasma membrane; integral to membrane

Molecular Function: IgG binding; beta-2-microglobulin binding; IgG receptor activity; antigen binding

Biological Process: antigen processing and presentation; immune response

Research Articles on FCGRT

Similar Products

Product Notes

The FCGRT fcgrt (Catalog #AAA3248351) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The FCGRT Peptide - middle region reacts with Mouse and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: Synthetic peptide located within the following region: DPCGAWMWEN QVSWYWEKET TDLKSKEQLF LEALKTLEKI LNGTYTLQGL. It is sometimes possible for the material contained within the vial of "FCGRT, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.