Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-PAGE

Dual specificity protein phosphatase 13 isoform B Recombinant Protein | DUSP13 recombinant protein

Recombinant Human Dual specificity protein phosphatase 13 isoform B

Gene Names
DUSP13; BEDP; MDSP; TMDP; SKRP4; DUSP13A; DUSP13B
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Dual specificity protein phosphatase 13 isoform B; Recombinant Human Dual specificity protein phosphatase 13 isoform B; Branching-enzyme interacting DSP; Muscle-restricted DSP; MDSP; DUSP13 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-198aa; Full Length
Sequence
MAETSLPELGGEDKATPCPSILELEELLRAGKSSCSRVDEVWPNLFIGDAATANNRFELWKLGITHVLNAAHKGLYCQGGPDFYGSSVSYLGVPAHDLPDFDISAYFSSAADFIHRALNTPGAKVLVHCVVGVSRSATLVLAYLMLHQRLSLRQAVITVRQHRWVFPNRGFLHQLCRLDQQLRGAGQS
Sequence Length
188
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

SDS-PAGE
Related Product Information for DUSP13 recombinant protein
Probable protein tyrosine phosphatase. Has a phosphatase activity-independent regulatory role in MAP3K5/ASK1-mediated apoptosis, preventing MAP3K5/ASK1 inhibition by AKT1. Shows no phosphatase activity on MAPK1/ERK2, MAPK8/JNK, MAPK14/p38 and MAP3K5/ASK1.
Product Categories/Family for DUSP13 recombinant protein
References
Characterization of two distinct dual specificity phosphatases encoded in alternative open reading frames of a single gene located on human chromosome 10q22.2.Chen H.-H., Luche R., Wei B., Tonks N.K.J. Biol. Chem. 279:41404-41413(2004) Identification of novel dual-specificity protein phosphatase which interacts with glycogen-branching enzyme.Skurat A.V., Dietrich A.D. Complete sequencing and characterization of 21,243 full-length human cDNAs.Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S., Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.Nat. Genet. 36:40-45(2004)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
36.7 kDa
NCBI Official Full Name
dual specificity protein phosphatase 13 isoform 1
NCBI Official Synonym Full Names
dual specificity phosphatase 13
NCBI Official Symbol
DUSP13
NCBI Official Synonym Symbols
BEDP; MDSP; TMDP; SKRP4; DUSP13A; DUSP13B
NCBI Protein Information
dual specificity protein phosphatase 13
UniProt Protein Name
Dual specificity protein phosphatase 13 isoform A
UniProt Gene Name
DUSP13
UniProt Synonym Gene Names
BEDP; DUSP13A; MDSP; DUSP13A; MDSP
UniProt Entry Name
DS13A_HUMAN

NCBI Description

Members of the protein-tyrosine phosphatase superfamily cooperate with protein kinases to regulate cell proliferation and differentiation. This superfamily is separated into two families based on the substrate that is dephosphorylated. One family, the dual specificity phosphatases (DSPs) acts on both phosphotyrosine and phosphoserine/threonine residues. This gene encodes different but related DSP proteins through the use of non-overlapping open reading frames, alternate splicing, and presumed different transcription promoters. Expression of the distinct proteins from this gene has been found to be tissue specific and the proteins may be involved in postnatal development of specific tissues. A protein encoded by the upstream ORF was found in skeletal muscle, whereas the encoded protein from the downstream ORF was found only in testis. In mouse, a similar pattern of expression was found. Multiple alternatively spliced transcript variants were described, but the full-length sequence of only some were determined. [provided by RefSeq, Jul 2008]

Uniprot Description

DUSP13 iso5: May be involved in the regulation of meiosis and/or differentiation of testicular germ cells during spermatogenesis. Exhibits intrinsic phosphatase activity towards both phospho- seryl/threonyl and -tyrosyl residues of myelin basic protein, with similar specific activities in vitro. Belongs to the protein-tyrosine phosphatase family. Non-receptor class dual specificity subfamily. 5 isoforms of the human protein are produced by alternative promoter.

Protein type: Protein phosphatase, dual-specificity; EC 3.1.3.48; Motility/polarity/chemotaxis; EC 3.1.3.16; Cell cycle regulation

Chromosomal Location of Human Ortholog: 10q22.2

Cellular Component: cytoplasm

Molecular Function: protein binding; protein tyrosine phosphatase activity; protein tyrosine/serine/threonine phosphatase activity

Biological Process: meiosis; protein amino acid dephosphorylation; spermatogenesis

Research Articles on DUSP13

Similar Products

Product Notes

The DUSP13 dusp13 (Catalog #AAA1385001) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-198aa; Full Length. The amino acid sequence is listed below: MAETSLPELG GEDKATPCPS ILELEELLRA GKSSCSRVDE VWPNLFIGDA ATANNRFELW KLGITHVLNA AHKGLYCQGG PDFYGSSVSY LGVPAHDLPD FDISAYFSSA ADFIHRALNT PGAKVLVHCV VGVSRSATLV LAYLMLHQRL SLRQAVITVR QHRWVFPNRG FLHQLCRLDQ QLRGAGQS. It is sometimes possible for the material contained within the vial of "Dual specificity protein phosphatase 13 isoform B, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.