ARHGEF9 blocking peptide
ARHGEF9 Peptide - C-terminal region
Gene Names
ARHGEF9; PEM2; EIEE8; PEM-2; HPEM-2; COLLYBISTIN
Reactivity
Mouse
Applications
Western Blot
Synonyms
ARHGEF9; ARHGEF9 Peptide - C-terminal region; ARHGEF9 blocking peptide
Reactivity
Mouse
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: KRQAAMTVRKASKQKGVNSARSVPPSYPPPQDPLNQGQYLVPDGIAQSQV
Sequence Length
463
Applicable Applications for ARHGEF9 blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for ARHGEF9 blocking peptide
This is a synthetic peptide designed for use in combination with anti-ARHGEF9 Antibody, made
Product Categories/Family for ARHGEF9 blocking peptide
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
55 kDa
NCBI Official Full Name
rho guanine nucleotide exchange factor 9 isoform 2
NCBI Official Synonym Full Names
Cdc42 guanine nucleotide exchange factor 9
NCBI Official Symbol
ARHGEF9
NCBI Official Synonym Symbols
PEM2; EIEE8; PEM-2; HPEM-2; COLLYBISTIN
NCBI Protein Information
rho guanine nucleotide exchange factor 9
Protein Family
NCBI Description
The protein encoded by this gene is a Rho-like GTPase that switches between the active (GTP-bound) state and inactive (GDP-bound) state to regulate CDC42 and other genes. This brain-specific protein also acts as an adaptor protein for the recruitment of gephyrin and together these proteins facilitate receceptor recruitement in GABAnergic and glycinergic synapses. Defects in this gene are the cause of startle disease with epilepsy (STHEE), also known as hyperekplexia with epilepsy, as well as several other types of cognitive disability. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2017]
Research Articles on ARHGEF9
1. Autism spectrum disorder patient with the smallest inactivating deletion in the collybistin gene.
Similar Products
Product Notes
The ARHGEF9 (Catalog #AAA3245668) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The ARHGEF9 Peptide - C-terminal region reacts with Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's ARHGEF9 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ARHGEF9 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: KRQAAMTVRK ASKQKGVNSA RSVPPSYPPP QDPLNQGQYL VPDGIAQSQV. It is sometimes possible for the material contained within the vial of "ARHGEF9, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
