Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37kD).)

Mouse anti-Human ZSCAN29 Monoclonal Antibody | anti-ZSCAN29 antibody

ZSCAN29 (Zinc Finger and SCAN Domain-containing Protein 29, Zinc Finger Protein 690, Zfp690, ZNF690) (FITC)

Gene Names
ZSCAN29; ZNF690; Zfp690
Reactivity
Human
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
ZSCAN29; Monoclonal Antibody; ZSCAN29 (Zinc Finger and SCAN Domain-containing Protein 29; Zinc Finger Protein 690; Zfp690; ZNF690) (FITC); anti-ZSCAN29 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2E8
Specificity
Recognizes human ZSCAN29.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Applicable Applications for anti-ZSCAN29 antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes
IHC-P: 3ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant protein corresponding to aa101-200 from human ZSCAN29 (NP_689668) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
RPRSSVTVSVKGQEVRLEKMTPPKSSQELLSVRQESVEPQPRGVPKKERARSPDLGPQEQMNPKEKLKPFQRSGLPFPKSGVVSRLEQGEPWIPDLLGS
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37kD).)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to ZSCAN29 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3ug/ml].)

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to ZSCAN29 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged ZSCAN29 is 0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged ZSCAN29 is 0.03ng/ml as a capture antibody.)
Product Categories/Family for anti-ZSCAN29 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
53,209 Da
NCBI Official Full Name
zinc finger and SCAN domain-containing protein 29
NCBI Official Synonym Full Names
zinc finger and SCAN domain containing 29
NCBI Official Symbol
ZSCAN29
NCBI Official Synonym Symbols
ZNF690; Zfp690
NCBI Protein Information
zinc finger and SCAN domain-containing protein 29; KOX31-like zinc finger protein; zinc finger protein 690
UniProt Protein Name
Zinc finger and SCAN domain-containing protein 29
UniProt Gene Name
ZSCAN29
UniProt Synonym Gene Names
ZNF690
UniProt Entry Name
ZSC29_HUMAN

Similar Products

Product Notes

The ZSCAN29 zscan29 (Catalog #AAA6150621) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ZSCAN29 (Zinc Finger and SCAN Domain-containing Protein 29, Zinc Finger Protein 690, Zfp690, ZNF690) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ZSCAN29 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB). IHC-P: 3ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ZSCAN29 zscan29 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ZSCAN29, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.