Mouse anti-Human ZSCAN29 Monoclonal Antibody | anti-ZSCAN29 antibody

ZSCAN29 (Zinc Finger and SCAN Domain-containing Protein 29, Zinc Finger Protein 690, Zfp690, ZNF690)

Cat. Num. AAA6011755

• Gene Names: ZSCAN29; ZNF690; Zfp690
• Reactivity: Human
• Applications: ELISA, Western Blot, Immunohistochemistry
• Purity: Affinity Purified; Purified by Protein A affinity chromatography.
• Synonyms: ZSCAN29; Monoclonal Antibody; ZSCAN29 (Zinc Finger and SCAN Domain-containing Protein 29; Zinc Finger Protein 690; Zfp690; ZNF690); Anti -ZSCAN29 (Zinc Finger and SCAN Domain-containing Protein 29; anti-ZSCAN29 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 2E8
• Specificity: Recognizes human ZSCAN29.
• Purity/Purification: Affinity Purified; Purified by Protein A affinity chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2.
• Sequence: RPRSSVTVSVKGQEVRLEKMTPPKSSQELLSVRQESVEPQPRGVPKKERARSPDLGPQEQMNPKEKLKPFQRSGLPFPKSGVVSRLEQGEPWIPDLLGS

• Applicable Applications for anti-ZSCAN29 antibody: ELISA (EL/EIA), Western Blot (WB), Immunohistochemistry (IHC)
• Application Notes: Suitable for use in ELISA, Western Blot and Immunohistochemistry.; Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml
• Immunogen: Partial recombinant protein corresponding to aa101-200 from human ZSCAN29 (NP_689668) with GST tag. MW of the GST tag alone is 26kD.
• Preparation and Storage: May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37kD).)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to ZSCAN29 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged ZSCAN29 is 0.03ng/ml as a capture antibody.)

Product Categories/Family for anti-ZSCAN29 antibody

Antibodies; Abs to Transcription Factors; Zinc (Ring) Finger

NCBI and Uniprot Product Information

• NCBI GI #: 116283915
• NCBI GeneID: 146050
• UniProt Accession #: Q8IWY8; Q32M75; Q32M76; Q8NA40; B3KVB9
• Molecular Weight: 96,719 Da
• NCBI Official Full Name: ZSCAN29 protein
• NCBI Official Synonym Full Names: zinc finger and SCAN domain containing 29
• NCBI Official Symbol: ZSCAN29
• NCBI Official Synonym Symbols: ZNF690; Zfp690
• NCBI Protein Information: zinc finger and SCAN domain-containing protein 29; zinc finger protein 690; KOX31-like zinc finger protein
• UniProt Protein Name: Zinc finger and SCAN domain-containing protein 29
• Protein Family: Zinc finger and SCAN domain-containing protein
• UniProt Gene Name: ZSCAN29
• UniProt Synonym Gene Names: ZNF690
• UniProt Entry Name: ZSC29_HUMAN

Uniprot Description

ZNF690: May be involved in transcriptional regulation. Belongs to the krueppel C2H2-type zinc-finger protein family. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: Transcription factor; C2H2-type zinc finger protein; DNA-binding

Chromosomal Location of Human Ortholog: 15q15.3

Cellular Component: nucleus

Molecular Function: DNA binding; metal ion binding

Biological Process: regulation of transcription from RNA polymerase II promoter; transcription from RNA polymerase II promoter