Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Mouse ZSCAN21 Monoclonal Antibody | anti-ZSCAN21 antibody

ZSCAN21 (Zinc Finger and SCAN Domain Containing 21, DKFZp434L134, DKFZp686H10254, NY-REN-21, ZNF38, Zipro1) (AP)

Gene Names
ZSCAN21; ZNF38; Zipro1; NY-REN-21
Applications
ELISA, Western Blot
Purity
Purified
Synonyms
ZSCAN21; Monoclonal Antibody; ZSCAN21 (Zinc Finger and SCAN Domain Containing 21; DKFZp434L134; DKFZp686H10254; NY-REN-21; ZNF38; Zipro1) (AP); Zinc Finger and SCAN Domain Containing 21; Zipro1; anti-ZSCAN21 antibody
Ordering
 
When autocomplete results are available use up and down arrows to review and enter to select. Touch device users, explore by touch or with swipe gestures.
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4F10
Specificity
Recognizes ZSCAN21.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-ZSCAN21 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
ZSCAN21 (NP_666019, 136aa-224aa) full-length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
TPPNEQKPVWEKISSSGTAKESPSSMQPQPLETSHKYESWGPLYIQESGEEQEFAQDPRKVRDCRLSTQHEESADEQKGSEAEGLKGDI
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of ZSCAN21 expression in transfected 293T cell line by ZNF38 monoclonal antibody (M16), clone 4F10.Lane 1: ZSCAN21 transfected lysate(50.9 KDa).Lane 2: Non-transfected lysate.)

Related Product Information for anti-ZSCAN21 antibody
Mouse monoclonal antibody raised against a full length recombinant ZSCAN21.
Product Categories/Family for anti-ZSCAN21 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
53,658 Da
NCBI Official Full Name
zinc finger and SCAN domain-containing protein 21
NCBI Official Synonym Full Names
zinc finger and SCAN domain containing 21
NCBI Official Symbol
ZSCAN21
NCBI Official Synonym Symbols
ZNF38; Zipro1; NY-REN-21
NCBI Protein Information
zinc finger and SCAN domain-containing protein 21; renal carcinoma antigen NY-REN-21; zfp-38; zinc finger protein 38 (KOX 25); zinc finger protein 38 homolog; zinc finger protein NY-REN-21 antigen
UniProt Protein Name
Zinc finger and SCAN domain-containing protein 21
UniProt Gene Name
ZSCAN21
UniProt Synonym Gene Names
ZFP38; ZNF38; Zfp-38
UniProt Entry Name
ZSC21_HUMAN

Similar Products

Product Notes

The ZSCAN21 zscan21 (Catalog #AAA6163448) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's ZSCAN21 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ZSCAN21 zscan21 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ZSCAN21, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.
Looking for a specific manual?
Request a Manual