Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.89kD).)

Mouse anti-Human ZHX2 Monoclonal Antibody | anti-ZHX2 antibody

ZHX2 (Zinc Fingers and Homeoboxes Protein 2, Zinc Finger and Homeodomain Protein 2, Alpha-fetoprotein Regulator 1, AFP Regulator 1, AFR1, KIAA0854, Regulator of AFP, RAF) (FITC)

Gene Names
ZHX2; RAF; AFR1
Reactivity
Human
Applications
ELISA, Immunofluorescence, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
ZHX2; Monoclonal Antibody; ZHX2 (Zinc Fingers and Homeoboxes Protein 2; Zinc Finger and Homeodomain Protein 2; Alpha-fetoprotein Regulator 1; AFP Regulator 1; AFR1; KIAA0854; Regulator of AFP; RAF) (FITC); anti-ZHX2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
5E2
Specificity
Recognizes human ZHX2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Sequence Length
4361
Applicable Applications for anti-ZHX2 antibody
ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes
IHC-P: 3ug/ml
IF: 10ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa691-789 from ZHX2 (NP_055758) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MEQYQHQPMADDHGYDAVARKATKPMAESPKNGGDVVPQYYKDPKKLCEEDLEKLVTRVKVGSEPAKDCLPAKPSEATSDRSEGSSRDGQGSDENEES*
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.89kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.89kD).)

Western Blot (WB)

(Western Blot analysis of ZHX2 expression in transfected 293T cell line by ZHX2 monoclonal antibody Lane 1: ZHX2 transfected lysate (92.307kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of ZHX2 expression in transfected 293T cell line by ZHX2 monoclonal antibody Lane 1: ZHX2 transfected lysate (92.307kD). Lane 2: Non-transfected lysate.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to ZHX2 on formalin-fixed paraffin-embedded human smooth muscle. [antibody concentration 3ug/ml])

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to ZHX2 on formalin-fixed paraffin-embedded human smooth muscle. [antibody concentration 3ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to ZHX2 on HeLa cell. [antibody concentration 10ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to ZHX2 on HeLa cell. [antibody concentration 10ug/ml])

Western Blot (WB)

(Western blot analysis of ZHX2 over-expressed 293 cell line, cotransfected with ZHX2 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with ZHX2 monoclonal antibody GAPDH (36.1kD) used as specificity and loading control.)

Western Blot (WB) (Western blot analysis of ZHX2 over-expressed 293 cell line, cotransfected with ZHX2 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with ZHX2 monoclonal antibody GAPDH (36.1kD) used as specificity and loading control.)
Product Categories/Family for anti-ZHX2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
Homo sapiens zinc fingers and homeoboxes 2 (ZHX2), transcript variant 2, mRNA
NCBI Official Synonym Full Names
zinc fingers and homeoboxes 2
NCBI Official Symbol
ZHX2
NCBI Official Synonym Symbols
RAF; AFR1
NCBI Protein Information
zinc fingers and homeoboxes protein 2
UniProt Protein Name
Zinc fingers and homeoboxes protein 2
UniProt Gene Name
ZHX2
UniProt Synonym Gene Names
AFR1; KIAA0854; RAF; AFP regulator 1
UniProt Entry Name
ZHX2_HUMAN

NCBI Description

The members of the zinc fingers and homeoboxes gene family are nuclear homodimeric transcriptional repressors that interact with the A subunit of nuclear factor-Y (NF-YA) and contain two C2H2-type zinc fingers and five homeobox DNA-binding domains. This gene encodes member 2 of this gene family. In addition to forming homodimers, this protein heterodimerizes with member 1 of the zinc fingers and homeoboxes family. [provided by RefSeq, Jul 2008]

Research Articles on ZHX2

Similar Products

Product Notes

The ZHX2 zhx2 (Catalog #AAA6150528) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ZHX2 (Zinc Fingers and Homeoboxes Protein 2, Zinc Finger and Homeodomain Protein 2, Alpha-fetoprotein Regulator 1, AFP Regulator 1, AFR1, KIAA0854, Regulator of AFP, RAF) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ZHX2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC) Paraffin, Western Blot (WB). IHC-P: 3ug/ml IF: 10ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ZHX2 zhx2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ZHX2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.