RAGE Polyclonal Antibody | anti-RAGE antibody

Anti-RAGE Antibody

Cat. Num. AAA178004

• Gene Names: AGER; RAGE; SCARJ1
• Reactivity: Human, Mouse, Rat
• Applications: Western Blot, Immunohistochemistry
• Purity: Immunogen Affinity Purified
• Synonyms: RAGE; Polyclonal Antibody; Anti-RAGE Antibody; Advanced glycosylation end product-specific receptor; AGER; MGC2235; MGC22357; RAGE_HUMAN; Receptor for advanced glycation endproducts; Receptor for advanced glycosylation end products; advanced glycosylation end product-specific receptor; anti-RAGE antibody

• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Purity/Purification: Immunogen Affinity Purified
• Form/Format: Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
• Sequence Length: 404

• Applicable Applications for anti-RAGE antibody: Western Blot (WB), Immunohistochemistry (IHC) Paraffin
• Application Notes: Western Blot Concentration: 0.1-0.5ug/ml; Immunohistochemistry (IHC) Paraffin Concentration: 0.5-1ug/ml
• Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human RAGE (91-120aa IQDEGIFRCQAMNRNGKETKSNYRVRVYQI), different from the related mouse and rat sequences by six amino acids.
• Ig Type: Rabbit IgG
• Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Preparation and Storage: At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

Western Blot (WB)

(Anti- RAGE Picoband antibody, MBS178004, Western blottingAll lanes: Anti RAGE (MBS178004) at 0.5ug/mlLane 1: Rat Lung Tissue Lysate at 50ugLane 2: RH35 Whole Cell Lysate at 40ugLane 3: HELA Whole Cell Lysate at 40ugPredicted bind size: 43KDObserved bind size: 43KD )

Immunohistochemistry (IHC)

(Anti- RAGE Picoband antibody, MBS178004, IHC(P)IHC(P): Mouse Lung Tissue )

Immunohistochemistry (IHC)

(Anti- RAGE Picoband antibody, MBS178004, IHC(P)IHC(P): Rat Lung Tissue )

Immunohistochemistry (IHC)

(Anti- RAGE Picoband antibody, MBS178004, IHC(P)IHC(P): Human Intestinal Cancer Tissue )

Related Product Information for anti-RAGE antibody

Description: Rabbit IgG polyclonal antibody for Advanced glycosylation end product-specific receptor (AGER) detection. Tested with WB, IHC-P in Human;Mouse;Rat.

Background: The receptor for advanced glycation end products (RAGE) is a multi-ligand member of the immunoglobulin superfamily of cell surface molecules. It interacts with distinct molecules implicated in homeostasis, development and inflammation, and certain diseases such as diabetes and Alzheimer's disease. RAGE is also a central cell surface receptor for amphoterin and EN-RAGE. And RAGE is associated with sustained NF-kappaB activation in the diabetic microenvironment and has a central role in sensory neuronal dysfunction. Moreover, RAGE propagates cellular dysfunction in several inflammatory disorders and diabetes, and it also functions as an endothelial adhesion receptor promoting leukocyte recruitment.

References

1. Bierhaus A, Haslbeck KM, Humpert PM, Liliensiek B, Dehmer T, Morcos M, Sayed AA, Andrassy M, Schiekofer S, Schneider JG, Schulz JB, Heuss D, Neundorfer B, Dierl S, Huber J, Tritschler H, Schmidt AM, Schwaninger M, Haering HU, Schleicher E, Kasper M, Stern DM, Arnold B, Nawroth PP. Loss of pain perception in diabetes is dependent on a receptor of the immunoglobulin superfamily. J Clin Invest. 2004 Dec; 114(12):1741-51. 2. Chavakis T, Bierhaus A, Al-Fakhri N, Schneider D, Witte S, Linn T, Nagashima M, Morser J, Arnold B, Preissner KT, Nawroth PP. The pattern recognition receptor (RAGE) is a counterreceptor for leukocyte integrins: a novel pathway for inflammatory cell recruitment. J Exp Med. 2003 Nov 17; 198(10):1507-15. 3. Hofmann MA, Drury S, Fu C, Qu W, Taguchi A, Lu Y, Avila C, Kambham N, Bierhaus A, Nawroth P, Neurath MF, Slattery T, Beach D, McClary J, Nagashima M, Morser J, Stern D, Schmidt AM. RAGE mediates a novel proinflammatory axis: a central cell surface receptor for S100/calgranulin polypeptides. Cell. 1999 Jun 25; 97(7):889-901. 4. Taguchi A, Blood DC, del Toro G, Canet A, Lee DC, Qu W, Tanji N, Lu Y, Lalla E, Fu C, Hofmann MA, Kislinger T, Ingram M, Lu A, Tanaka H, Hori O, Ogawa S, Stern DM, Schmidt AM. Blockade of RAGE-amphoterin signalling suppresses tumour growth and metastases. Nature.2000 May 18; 405(6784):354-60.

NCBI and Uniprot Product Information

• NCBI GI #: 10835203
• NCBI GeneID: 177
• NCBI Accession #: NP_001127.1
• NCBI GenBank Nucleotide #: NM_001136.4
• UniProt Accession #: Q15109; Q15279; Q3L1R4; Q3L1R5; Q3L1R6; Q3L1R7; Q3L1R8; Q3L1S0; A2BFI7; A6NKF0; A7Y2U9; B0V176
• Molecular Weight: 41,098 Da
• NCBI Official Full Name: advanced glycosylation end product-specific receptor isoform 1
• NCBI Official Synonym Full Names: advanced glycosylation end product-specific receptor
• NCBI Official Symbol: AGER
• NCBI Official Synonym Symbols: RAGE; SCARJ1
• NCBI Protein Information: advanced glycosylation end product-specific receptor
• UniProt Protein Name: Advanced glycosylation end product-specific receptor
• UniProt Gene Name: AGER
• UniProt Synonym Gene Names: RAGE
• UniProt Entry Name: RAGE_HUMAN

NCBI Description

The advanced glycosylation end product (AGE) receptor encoded by this gene is a member of the immunoglobulin superfamily of cell surface receptors. It is a multiligand receptor, and besides AGE, interacts with other molecules implicated in homeostasis, development, and inflammation, and certain diseases, such as diabetes and Alzheimer's disease. Many alternatively spliced transcript variants encoding different isoforms, as well as non-protein-coding variants, have been described for this gene (PMID:18089847). [provided by RefSeq, May 2011]

Uniprot Description

Mediates interactions of advanced glycosylation end products (AGE). These are nonenzymatically glycosylated proteins which accumulate in vascular tissue in aging and at an accelerated rate in diabetes. Acts as a mediator of both acute and chronic vascular inflammation in conditions such as atherosclerosis and in particular as a complication of diabetes. AGE/RAGE signaling plays an important role in regulating the production/expression of TNF-alpha, oxidative stress, and endothelial dysfunction in type 2 diabetes. Interaction with S100A12 on endothelium, mononuclear phagocytes, and lymphocytes triggers cellular activation, with generation of key proinflammatory mediators. Interaction with S100B after myocardial infarction may play a role in myocyte apoptosis by activating ERK1/2 and p53/TP53 signaling (). Receptor for amyloid beta peptide. Contributes to the translocation of amyloid-beta peptide (ABPP) across the cell membrane from the extracellular to the intracellular space in cortical neurons. ABPP-initiated RAGE signaling, especially stimulation of p38 mitogen-activated protein kinase (MAPK), has the capacity to drive a transport system delivering ABPP as a complex with RAGE to the intraneuronal space. Can also bind oligonucleotides.