Western Blot (WB)
(Western Blot detection against Immunogen (43.16kD).)
Mouse anti-Human ZG16B Monoclonal Antibody | anti-ZG16B antibody
ZG16B (LOC124220, Zymogen Granule Protein 16 Homolog B, UNQ773/PRO1567)
Gene Names
ZG16B; EECP; PAUF; JCLN2; HRPE773; PRO1567
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Affinity PurifiedPurified by Protein A affinity chromatography.
Synonyms
ZG16B; Monoclonal Antibody; ZG16B (LOC124220; Zymogen Granule Protein 16 Homolog B; UNQ773/PRO1567); Anti -ZG16B (LOC124220; anti-ZG16B antibody
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
4D1-1B11
Specificity
Recognizes human LOC124220.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
KMYGPGGGKYFSTTEDYDHEITGLRVSVGLLLVKSVQVKLGDSWDVKLGALGGNTQEVTLQPGEYITKVFVAFQAFLRGMVMYTSKDRYFYFGKLDGQISSAYPSQEGQVLVGIYGQYQLLGIKSIGFEWNYPLEEPTTEPPVNLTYSANSPVGR
Applicable Applications for anti-ZG16B antibody
ELISA (EL/EIA), Western Blot (WB)
Application Notes
Suitable for use in ELISA and Western Blot.
Immunogen
Full length recombinant corresponding to aa18-173 from human LOC124220 (AAH09722) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Western Blot (WB)
(Western Blot detection against Immunogen (43.16kD).)
Western Blot (WB)
(Western Blot detection against Immunogen (43.16kD).)
Testing Data
(Detection limit for recombinant GST tagged LOC124220 is ~0.03ng/ml as a capture antibody.)
Testing Data
(Detection limit for recombinant GST tagged LOC124220 is ~0.03ng/ml as a capture antibody.)
Product Categories/Family for anti-ZG16B antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
22,739 Da
NCBI Official Full Name
zymogen granule protein 16 homolog B
NCBI Official Synonym Full Names
zymogen granule protein 16B
NCBI Official Symbol
ZG16B
NCBI Official Synonym Symbols
EECP; PAUF; JCLN2; HRPE773; PRO1567
NCBI Protein Information
zymogen granule protein 16 homolog B; endocrine and exocrine protein; jacalin-like lectin domain containing 2; pancreatic adenocarcinoma upregulated factor
UniProt Protein Name
Zymogen granule protein 16 homolog B
Protein Family
UniProt Gene Name
ZG16B
UniProt Entry Name
ZG16B_HUMAN
Uniprot Description
ZG16B: Belongs to the jacalin lectin family.
Protein type: Secreted, signal peptide; Secreted
Chromosomal Location of Human Ortholog: 16p13.3
Cellular Component: extracellular space
Molecular Function: carbohydrate binding
Biological Process: retinal homeostasis
Research Articles on ZG16B
Similar Products
Product Notes
The ZG16B zg16b (Catalog #AAA6009979) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ZG16B (LOC124220, Zymogen Granule Protein 16 Homolog B, UNQ773/PRO1567) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ZG16B can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA), Western Blot (WB). Suitable for use in ELISA and Western Blot. Researchers should empirically determine the suitability of the ZG16B zg16b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: KMYGPGGGKY FSTTEDYDHE ITGLRVSVGL LLVKSVQVKL GDSWDVKLGA LGGNTQEVTL QPGEYITKVF VAFQAFLRGM VMYTSKDRYF YFGKLDGQIS SAYPSQEGQV LVGIYGQYQL LGIKSIGFEW NYPLEEPTTE PPVNLTYSAN SPVGR. It is sometimes possible for the material contained within the vial of "ZG16B, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
