Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged ZBTB25 is 0.3 ng/ml as a capture antibody.)

Mouse ZBTB25 Monoclonal Antibody | anti-ZBTB25 antibody

ZBTB25 (Zinc Finger and BTB Domain Containing 25, KUP, ZNF46) (HRP)

Gene Names
ZBTB25; KUP; ZNF46; C14orf51
Applications
ELISA
Purity
Purified
Synonyms
ZBTB25; Monoclonal Antibody; ZBTB25 (Zinc Finger and BTB Domain Containing 25; KUP; ZNF46) (HRP); Zinc Finger and BTB Domain Containing 25; ZNF46; anti-ZBTB25 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2D1
Specificity
Recognizes ZBTB25.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Applicable Applications for anti-ZBTB25 antibody
ELISA (EIA)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
ZBTB25 (NP_008908.2, 331aa-435aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
DTEPVELNCNFSFSRKRKMSCTICGHKFPRKSQLLEHMYTHKGKSYRYNRCQRFGNALAQRFQPYCDSWSDVSLKSSRLSQEHLDLPCALESELTQENVDTILVE
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged ZBTB25 is 0.3 ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged ZBTB25 is 0.3 ng/ml as a capture antibody.)
Product Categories/Family for anti-ZBTB25 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
48,990 Da
NCBI Official Full Name
zinc finger and BTB domain-containing protein 25
NCBI Official Synonym Full Names
zinc finger and BTB domain containing 25
NCBI Official Symbol
ZBTB25
NCBI Official Synonym Symbols
KUP; ZNF46; C14orf51
NCBI Protein Information
zinc finger and BTB domain-containing protein 25; zinc finger protein 46; zinc finger protein KUP
UniProt Protein Name
Zinc finger and BTB domain-containing protein 25
UniProt Gene Name
ZBTB25
UniProt Synonym Gene Names
C14orf51; KUP; ZNF46
UniProt Entry Name
ZBT25_HUMAN

Uniprot Description

ZBTB25: May be involved in transcriptional regulation.

Protein type: C2H2-type zinc finger protein

Chromosomal Location of Human Ortholog: 14q23-q24

Cellular Component: nucleoplasm; cytoplasm

Molecular Function: protein binding; DNA binding; metal ion binding; transcription factor activity

Biological Process: transcription, DNA-dependent; regulation of transcription, DNA-dependent; gene expression

Research Articles on ZBTB25

Similar Products

Product Notes

The ZBTB25 zbtb25 (Catalog #AAA6182283) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's ZBTB25 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ZBTB25 zbtb25 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ZBTB25, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.