Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human XRCC6BP1 Monoclonal Antibody | anti-XRCC6BP1 antibody

XRCC6BP1 (Mitochondrial Inner Membrane Protease ATP23 Homolog, Ku70-binding Protein 3, XRCC6-binding Protein 1, KUB3, MGC134817, MGC134818) (MaxLight 550)

Gene Names
ATP23; KUB3; XRCC6BP1
Reactivity
Human
Applications
FLISA
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
XRCC6BP1; Monoclonal Antibody; XRCC6BP1 (Mitochondrial Inner Membrane Protease ATP23 Homolog; Ku70-binding Protein 3; XRCC6-binding Protein 1; KUB3; MGC134817; MGC134818) (MaxLight 550); anti-XRCC6BP1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1G6
Specificity
Recognizes human XRCC6BP1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight550.
Applicable Applications for anti-XRCC6BP1 antibody
FLISA
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa152-247 from human XRCC6BP1 (NP_150592) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
VRAANLSGDCSLVNEIFRLHFGLKQHHQTCVRDRATLSILAVRNISKEVAKKAVDEVFESCFNDHEPFGRIPHNKTYARYAHRDFENRDRYYSNI
Conjugate
MaxLight550
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight550 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-XRCC6BP1 antibody
MaxLight550 is a new Yellow-Green photostable dye conjugate comparable to Alexa Fluor546, 555, DyLight549, Cy3, TRITC and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (550nm); Emission (575nm); Extinction Coefficient 150,000.
Product Categories/Family for anti-XRCC6BP1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
27kDa
NCBI Official Full Name
mitochondrial inner membrane protease ATP23 homolog isoform a
NCBI Official Synonym Full Names
ATP23 metallopeptidase and ATP synthase assembly factor homolog
NCBI Official Symbol
ATP23
NCBI Official Synonym Symbols
KUB3; XRCC6BP1
NCBI Protein Information
mitochondrial inner membrane protease ATP23 homolog
UniProt Protein Name
Mitochondrial inner membrane protease ATP23 homolog
UniProt Gene Name
XRCC6BP1
UniProt Synonym Gene Names
KUB3
UniProt Entry Name
ATP23_HUMAN

NCBI Description

The protein encoded by this gene is amplified in glioblastomas and interacts with the DNA binding subunit of DNA-dependent protein kinase. This kinase is involved in double-strand break repair (DSB), and higher expression of the encoded protein increases the efficiency of DSB. In addition, comparison to orthologous proteins strongly suggests that this protein is a metalloprotease important in the biosynthesis of mitochondrial ATPase. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Feb 2016]

Uniprot Description

Subunit structure: Interacts with XRCC6. Ref.1

Sequence similarities: Belongs to the peptidase M76 family.

Sequence caution: The sequence AAD31085.1 differs from that shown. Reason: Erroneous initiation.

Research Articles on XRCC6BP1

Similar Products

Product Notes

The XRCC6BP1 xrcc6bp1 (Catalog #AAA6214801) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The XRCC6BP1 (Mitochondrial Inner Membrane Protease ATP23 Homolog, Ku70-binding Protein 3, XRCC6-binding Protein 1, KUB3, MGC134817, MGC134818) (MaxLight 550) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's XRCC6BP1 can be used in a range of immunoassay formats including, but not limited to, FLISA. Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the XRCC6BP1 xrcc6bp1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "XRCC6BP1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.