Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged XRCC6BP1 is ~1ng/ml as a capture antibody.)

Mouse anti-Human XRCC6BP1 Monoclonal Antibody | anti-XRCC6BP1 antibody

XRCC6BP1 (Mitochondrial Inner Membrane Protease ATP23 Homolog, Ku70-binding Protein 3, XRCC6-binding Protein 1, KUB3, MGC134817, MGC134818)

Gene Names
XRCC6BP1; KUB3
Reactivity
Human
Applications
ELISA
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
XRCC6BP1; Monoclonal Antibody; XRCC6BP1 (Mitochondrial Inner Membrane Protease ATP23 Homolog; Ku70-binding Protein 3; XRCC6-binding Protein 1; KUB3; MGC134817; MGC134818); Anti -XRCC6BP1 (Mitochondrial Inner Membrane Protease ATP23 Homolog; anti-XRCC6BP1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1G6
Specificity
Recognizes human XRCC6BP1.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
VRAANLSGDCSLVNEIFRLHFGLKQHHQTCVRDRATLSILAVRNISKEVAKKAVDEVFESCFNDHEPFGRIPHNKTYARYAHRDFENRDRYYSNI
Applicable Applications for anti-XRCC6BP1 antibody
ELISA (EL/EIA)
Application Notes
Suitable for use in ELISA.
Immunogen
Partial recombinant corresponding to aa152-247 from human XRCC6BP1 (NP_150592) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged XRCC6BP1 is ~1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged XRCC6BP1 is ~1ng/ml as a capture antibody.)
Related Product Information for anti-XRCC6BP1 antibody
Interacts with XRCC6.
Product Categories/Family for anti-XRCC6BP1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
28,081 Da
NCBI Official Full Name
XRCC6BP1 protein
NCBI Official Synonym Full Names
XRCC6 binding protein 1
NCBI Official Symbol
XRCC6BP1
NCBI Official Synonym Symbols
KUB3
NCBI Protein Information
mitochondrial inner membrane protease ATP23 homolog; Ku70 binding protein 3; Ku70-binding protein 3; XRCC6-binding protein 1
UniProt Protein Name
Mitochondrial inner membrane protease ATP23 homolog
UniProt Gene Name
XRCC6BP1
UniProt Synonym Gene Names
KUB3
UniProt Entry Name
ATP23_HUMAN

Uniprot Description

XRCC6BP1: Belongs to the peptidase M76 family.

Protein type: EC 3.4.24.-; DNA repair, damage; Protease

Chromosomal Location of Human Ortholog: 12q14.1

Cellular Component: DNA-dependent protein kinase complex

Molecular Function: metalloendopeptidase activity; metal ion binding; DNA-dependent protein kinase activity

Biological Process: proteolysis; protein amino acid phosphorylation; double-strand break repair via nonhomologous end joining

Similar Products

Product Notes

The XRCC6BP1 xrcc6bp1 (Catalog #AAA6009722) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The XRCC6BP1 (Mitochondrial Inner Membrane Protease ATP23 Homolog, Ku70-binding Protein 3, XRCC6-binding Protein 1, KUB3, MGC134817, MGC134818) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's XRCC6BP1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA). Suitable for use in ELISA. Researchers should empirically determine the suitability of the XRCC6BP1 xrcc6bp1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: VRAANLSGDC SLVNEIFRLH FGLKQHHQTC VRDRATLSIL AVRNISKEVA KKAVDEVFES CFNDHEPFGR IPHNKTYARY AHRDFENRDR YYSNI. It is sometimes possible for the material contained within the vial of "XRCC6BP1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.