Mouse XBP1 Monoclonal Antibody | anti-XBP1 antibody

XBP1 (X-Box Binding Protein 1, TREB5, XBP2) (HRP)

Cat. Num. AAA6181305

• Gene Names: XBP1; XBP2; TREB5; XBP-1; TREB-5
• Applications: ELISA, Immunofluorescence, Western Blot
• Purity: Purified
• Synonyms: XBP1; Monoclonal Antibody; XBP1 (X-Box Binding Protein 1; TREB5; XBP2) (HRP); X-Box Binding Protein 1; XBP2; anti-XBP1 antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 3F5
• Specificity: Recognizes XBP1.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
• Sequence Length: 261

• Applicable Applications for anti-XBP1 antibody: ELISA (EIA), Immunofluorescence (IF), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: XBP1 (AAH12841, 123aa-225aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: THGLVVENQELRQRLGMDALVAEEEAEAKGNEVRPVAGSAESAALRLRAPLQQVQAQLSPLQNISPWILAVLTLQIQSLISCWAFWTTWTQSCSSNALPQSLP
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(XBP1 monoclonal antibody (M01), clone 3F5. Western Blot analysis of XBP1 expression in Hela S3 NE (Cat # L013V3).)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to XBP1 on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to XBP1 on HeLa cell. [antibody concentration 10 ug/ml])

Product Categories/Family for anti-XBP1 antibody

Antibodies; Binding Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 15277482
• NCBI GeneID: 7494
• NCBI Official Full Name: X-box binding protein 1
• NCBI Official Synonym Full Names: X-box binding protein 1
• NCBI Official Symbol: XBP1
• NCBI Official Synonym Symbols: XBP2; TREB5; XBP-1; TREB-5
• NCBI Protein Information: X-box-binding protein 1
• Protein Family: X-box-binding protein

NCBI Description

This gene encodes a transcription factor that regulates MHC class II genes by binding to a promoter element referred to as an X box. This gene product is a bZIP protein, which was also identified as a cellular transcription factor that binds to an enhancer in the promoter of the T cell leukemia virus type 1 promoter. It may increase expression of viral proteins by acting as the DNA binding partner of a viral transactivator. It has been found that upon accumulation of unfolded proteins in the endoplasmic reticulum (ER), the mRNA of this gene is processed to an active form by an unconventional splicing mechanism that is mediated by the endonuclease inositol-requiring enzyme 1 (IRE1). The resulting loss of 26 nt from the spliced mRNA causes a frame-shift and an isoform XBP1(S), which is the functionally active transcription factor. The isoform encoded by the unspliced mRNA, XBP1(U), is constitutively expressed, and thought to function as a negative feedback regulator of XBP1(S), which shuts off transcription of target genes during the recovery phase of ER stress. A pseudogene of XBP1 has been identified and localized to chromosome 5. [provided by RefSeq, Jul 2008]