Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (34.76kD).)

Mouse anti-Human WTAP Monoclonal Antibody | anti-WTAP antibody

WTAP (Wilms Tumor 1-associating Protein, WT1-associated Protein, Pre-mRNA-splicing Regulator WTAP, Female-lethal(2)D Homolog, hFL(2)D, KIAA0105) (AP)

Gene Names
WTAP; Mum2
Reactivity
Human
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
WTAP; Monoclonal Antibody; WTAP (Wilms Tumor 1-associating Protein; WT1-associated Protein; Pre-mRNA-splicing Regulator WTAP; Female-lethal(2)D Homolog; hFL(2)D; KIAA0105) (AP); anti-WTAP antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1B11
Specificity
Recognizes human WTAP.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Sequence Length
1724
Applicable Applications for anti-WTAP antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes
IHC-P: 3ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa70-151 from WTAP (NP_690596) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
ARRENILVMRLATKEQEMQECTTQIQYLKQVQQPSVAQLRSTMVDPAINLFFLKMKGELEQTKDKLEQAQNELSAWKFTPDR
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (34.76kD).)

Western Blot (WB) (Western Blot detection against Immunogen (34.76kD).)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to WTAP on formalin-fixed paraffin-embedded human kidney. [antibody concentration 3ug/ml])

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to WTAP on formalin-fixed paraffin-embedded human kidney. [antibody concentration 3ug/ml])

Testing Data

(Detection limit for recombinant GST tagged WTAP is 0.1ng/ml as a capture antibo)

Testing Data (Detection limit for recombinant GST tagged WTAP is 0.1ng/ml as a capture antibo)
Product Categories/Family for anti-WTAP antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
Homo sapiens WT1 associated protein (WTAP), transcript variant 2, mRNA
NCBI Official Synonym Full Names
WT1 associated protein
NCBI Official Symbol
WTAP
NCBI Official Synonym Symbols
Mum2
NCBI Protein Information
pre-mRNA-splicing regulator WTAP
UniProt Protein Name
Pre-mRNA-splicing regulator WTAP
UniProt Gene Name
WTAP
UniProt Synonym Gene Names
KIAA0105; hFL(2)D
UniProt Entry Name
FL2D_HUMAN

NCBI Description

The Wilms tumor suppressor gene WT1 appears to play a role in both transcriptional and posttranscriptional regulation of certain cellular genes. This gene encodes a WT1-associating protein, which is a ubiquitously expressed nuclear protein. Like WT1 protein, this protein is localized throughout the nucleoplasm as well as in speckles and partially colocalizes with splicing factors. Alternative splicing of this gene results in several transcript variants encoding three different isoforms. [provided by RefSeq, Jul 2012]

Uniprot Description

WTAP: Regulates G2/M cell-cycle transition by binding to the 3' UTR of CCNA2, which enhances its stability. Impairs WT1 DNA- binding ability and inhibits expression of WT1 target genes. May be involved in mRNA splicing regulation. Belongs to the fl(2)d family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Nucleolus; Spliceosome

Chromosomal Location of Human Ortholog: 6q25-q27

Cellular Component: nucleoplasm; nuclear membrane; nucleolus; nuclear speck; nucleus

Biological Process: RNA splicing; cell cycle; mRNA processing; regulation of alternative nuclear mRNA splicing, via spliceosome

Research Articles on WTAP

Similar Products

Product Notes

The WTAP wtap (Catalog #AAA6134577) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The WTAP (Wilms Tumor 1-associating Protein, WT1-associated Protein, Pre-mRNA-splicing Regulator WTAP, Female-lethal(2)D Homolog, hFL(2)D, KIAA0105) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's WTAP can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB). IHC-P: 3ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the WTAP wtap for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "WTAP, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.