Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37kD).)

Mouse anti-Human WRAP53 Monoclonal Antibody | anti-WRAP53 antibody

WRAP53 (WD40 Repeat-containing Protein Encoding RNA Antisense to p53, Telomerase Cajal Body Protein 1, TCAB1, WD Repeat-containing Protein 79, WDR79, DKCB3) (Biotin)

Gene Names
WRAP53; DKCB3; TCAB1; WDR79
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
WRAP53; Monoclonal Antibody; WRAP53 (WD40 Repeat-containing Protein Encoding RNA Antisense to p53; Telomerase Cajal Body Protein 1; TCAB1; WD Repeat-containing Protein 79; WDR79; DKCB3) (Biotin); anti-WRAP53 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1F12
Specificity
Recognizes human WDR79.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Sequence Length
548
Applicable Applications for anti-WRAP53 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa62-161 from human WDR79 (NP_060551) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
AVSQELREGDPVSLSTPLETEFGSPSELSPRIEEQELSENTSLPAEEANGSLSEEEANGPELGSGKAMEDTSGEPAAEDEGDTAWNYSFSQLPRFLSGS
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37kD).)

Western Blot (WB)

(WDR79 monoclonal antibody. Western Blot analysis of WDR79 expression in A-431.)

Western Blot (WB) (WDR79 monoclonal antibody. Western Blot analysis of WDR79 expression in A-431.)

Testing Data

(Detection limit for recombinant GST tagged WDR79 is 0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged WDR79 is 0.03ng/ml as a capture antibody.)
Product Categories/Family for anti-WRAP53 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
telomerase Cajal body protein 1
NCBI Official Synonym Full Names
WD repeat containing antisense to TP53
NCBI Official Symbol
WRAP53
NCBI Official Synonym Symbols
DKCB3; TCAB1; WDR79
NCBI Protein Information
telomerase Cajal body protein 1
UniProt Protein Name
Telomerase Cajal body protein 1
UniProt Gene Name
WRAP53
UniProt Synonym Gene Names
TCAB1; WDR79
UniProt Entry Name
WAP53_HUMAN

NCBI Description

This gene encodes an essential component of the telomerase holoenzyme complex, a ribonucleoprotein complex required for telomere synthesis. This protein is enriched in Cajal bodies, nuclear sites of RNP processing that are important for telomerase function. It interacts with dyskerin, TERT and TERC, other components of active telomerase, and with small Cajal body RNAs (scaRNAs), which are involved in modifying splicing RNAs. This mRNA also functions as a p53 antisense transcript, that regulates endogenous p53 mRNA levels and further induction of p53 protein by targeting the 5' untranslated region of p53 mRNA. Alternatively spliced transcript variants which differ only in the 5' UTR have been found for this gene. [provided by RefSeq, Mar 2011]

Uniprot Description

Function: Essential component of the telomerase holoenzyme complex, a ribonucleoprotein complex essential for the replication of chromosome termini that elongates telomeres in most eukaryotes. In the telomerase holoenzyme complex, it controls telomerase localization to Cajal body. Required for delivery of TERC to telomeres during S phase and for telomerase activity. Binds small Cajal body RNAs (scaRNAs). The mRNA encoding this protein plays a critical role in the regulation of p53 expression at the post-transcriptional level; it is involved both in maintaining basal p53 mRNA levels and in p53 induction upon DNA damage. Ref.11 Ref.13

Subunit structure: Component of the telomerase holoenzyme complex at least composed of TERT, DKC1, WRAP53/TCAB1, NOP10, NHP2, GAR1, TEP1, EST1A, POT1 and a telomerase RNA template component (TERC). Ref.13

Subcellular location: Nucleus › Cajal body. Cytoplasm Ref.11 Ref.13.

Tissue specificity: Expressed in all tissues and cell lines examined. Ref.11

Involvement in disease: Dyskeratosis congenita, autosomal recessive, 3 (DKCB3) [MIM:613988]: A rare multisystem disorder caused by defective telomere maintenance. It is characterized by progressive bone marrow failure, and the clinical triad of reticulated skin hyperpigmentation, nail dystrophy, and mucosal leukoplakia. Common but variable features include premature graying, aplastic anemia, low platelets, osteoporosis, pulmonary fibrosis, and liver fibrosis among others. Early mortality is often associated with bone marrow failure, infections, fatal pulmonary complications, or malignancy.Note: The disease is caused by mutations affecting the gene represented in this entry. Ref.16

Sequence similarities: Contains 6 WD repeats.

Research Articles on WRAP53

Similar Products

Product Notes

The WRAP53 wrap53 (Catalog #AAA6145173) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The WRAP53 (WD40 Repeat-containing Protein Encoding RNA Antisense to p53, Telomerase Cajal Body Protein 1, TCAB1, WD Repeat-containing Protein 79, WDR79, DKCB3) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's WRAP53 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the WRAP53 wrap53 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "WRAP53, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.