Mouse anti-Human WRAP53 Monoclonal Antibody | anti-WRAP53 antibody

WRAP53 (WD40 Repeat-containing Protein Encoding RNA Antisense to p53, Telomerase Cajal Body Protein 1, TCAB1, WD Repeat-containing Protein 79, WDR79, DKCB3) (FITC)

Cat. Num. AAA6150476

• Gene Names: WRAP53; DKCB3; TCAB1; WDR79
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: WRAP53; Monoclonal Antibody; WRAP53 (WD40 Repeat-containing Protein Encoding RNA Antisense to p53; Telomerase Cajal Body Protein 1; TCAB1; WD Repeat-containing Protein 79; WDR79; DKCB3) (FITC); anti-WRAP53 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 1F12
• Specificity: Recognizes human WDR79.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
• Sequence Length: 548

• Applicable Applications for anti-WRAP53 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa62-161 from human WDR79 (NP_060551) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: AVSQELREGDPVSLSTPLETEFGSPSELSPRIEEQELSENTSLPAEEANGSLSEEEANGPELGSGKAMEDTSGEPAAEDEGDTAWNYSFSQLPRFLSGS
• Conjugate: FITC
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37kD).)

Western Blot (WB)

(WDR79 monoclonal antibody. Western Blot analysis of WDR79 expression in A-431.)

Testing Data

(Detection limit for recombinant GST tagged WDR79 is 0.03ng/ml as a capture antibody.)

Product Categories/Family for anti-WRAP53 antibody

Antibodies; WD Repeat Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 221136854
• NCBI GeneID: 55135
• NCBI Accession #: NP_060551
• NCBI GenBank Nucleotide #: NM_018081
• UniProt Accession #: Q9BUR4
• NCBI Official Full Name: telomerase Cajal body protein 1
• NCBI Official Synonym Full Names: WD repeat containing antisense to TP53
• NCBI Official Symbol: WRAP53
• NCBI Official Synonym Symbols: DKCB3; TCAB1; WDR79
• NCBI Protein Information: telomerase Cajal body protein 1
• UniProt Protein Name: Telomerase Cajal body protein 1
• Protein Family: Telomerase Cajal body protein
• UniProt Gene Name: WRAP53
• UniProt Synonym Gene Names: TCAB1; WDR79
• UniProt Entry Name: WAP53_HUMAN

NCBI Description

This gene encodes an essential component of the telomerase holoenzyme complex, a ribonucleoprotein complex required for telomere synthesis. This protein is enriched in Cajal bodies, nuclear sites of RNP processing that are important for telomerase function. It interacts with dyskerin, TERT and TERC, other components of active telomerase, and with small Cajal body RNAs (scaRNAs), which are involved in modifying splicing RNAs. This mRNA also functions as a p53 antisense transcript, that regulates endogenous p53 mRNA levels and further induction of p53 protein by targeting the 5' untranslated region of p53 mRNA. Alternatively spliced transcript variants which differ only in the 5' UTR have been found for this gene. [provided by RefSeq, Mar 2011]

Uniprot Description

Function: Essential component of the telomerase holoenzyme complex, a ribonucleoprotein complex essential for the replication of chromosome termini that elongates telomeres in most eukaryotes. In the telomerase holoenzyme complex, it controls telomerase localization to Cajal body. Required for delivery of TERC to telomeres during S phase and for telomerase activity. Binds small Cajal body RNAs (scaRNAs). The mRNA encoding this protein plays a critical role in the regulation of p53 expression at the post-transcriptional level; it is involved both in maintaining basal p53 mRNA levels and in p53 induction upon DNA damage. Ref.11 Ref.13

Subunit structure: Component of the telomerase holoenzyme complex at least composed of TERT, DKC1, WRAP53/TCAB1, NOP10, NHP2, GAR1, TEP1, EST1A, POT1 and a telomerase RNA template component (TERC). Ref.13

Subcellular location: Nucleus › Cajal body. Cytoplasm Ref.11 Ref.13.

Tissue specificity: Expressed in all tissues and cell lines examined. Ref.11

Involvement in disease: Dyskeratosis congenita, autosomal recessive, 3 (DKCB3) [MIM:613988]: A rare multisystem disorder caused by defective telomere maintenance. It is characterized by progressive bone marrow failure, and the clinical triad of reticulated skin hyperpigmentation, nail dystrophy, and mucosal leukoplakia. Common but variable features include premature graying, aplastic anemia, low platelets, osteoporosis, pulmonary fibrosis, and liver fibrosis among others. Early mortality is often associated with bone marrow failure, infections, fatal pulmonary complications, or malignancy.Note: The disease is caused by mutations affecting the gene represented in this entry. Ref.16

Sequence similarities: Contains 6 WD repeats.