Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD).)

Mouse anti-Human WNK4 Monoclonal Antibody | anti-WNK4 antibody

WNK4 (Serine/threonine-protein Kinase WNK4, Protein Kinase Lysine-deficient 4, Protein Kinase with No Lysine 4, PRKWNK4, PHA2B) APC

Gene Names
WNK4; PHA2B; PRKWNK4
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
WNK4; Monoclonal Antibody; WNK4 (Serine/threonine-protein Kinase WNK4; Protein Kinase Lysine-deficient 4; Protein Kinase with No Lysine 4; PRKWNK4; PHA2B) APC; EC=2.7.11.1; anti-WNK4 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
1E6
Specificity
Recognizes human WNK4.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-WNK4 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1144-1244 from human WNK4 (NP_115763) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
KHLSEVETLQTLQKKEIEDLYSRLGKQPPPGIVAPAAMLSSRQRRLSKGSFPTSRRNSLQRSEPPGPGIMRRNSLSGSSTGSQEQRASKGVTFAGDVGRM
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.11kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD).)

Testing Data

(Detection limit for recombinant GST tagged WNK4 is 0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged WNK4 is 0.03ng/ml as a capture antibody.)
Product Categories/Family for anti-WNK4 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
134,739 Da
NCBI Official Full Name
serine/threonine-protein kinase WNK4
NCBI Official Synonym Full Names
WNK lysine deficient protein kinase 4
NCBI Official Symbol
WNK4
NCBI Official Synonym Symbols
PHA2B; PRKWNK4
NCBI Protein Information
serine/threonine-protein kinase WNK4; protein kinase with no lysine 4; protein kinase lysine-deficient 4
UniProt Protein Name
Serine/threonine-protein kinase WNK4
UniProt Gene Name
WNK4
UniProt Synonym Gene Names
PRKWNK4
UniProt Entry Name
WNK4_HUMAN

Uniprot Description

WNK4: Serine/threonine kinase which plays an important role in the regulation of electrolyte homeostasis, cell signaling, survival and proliferation. Acts as an activator and inhibitor of sodium-coupled chloride cotransporters and potassium-coupled chloride cotransporters respectively. Activates SCNN1A, SCNN1B, SCNN1D, SGK1, TRPV5 and TRPV6. Regulates the activity of the thiazide-sensitive Na-Cl cotransporter, SLC12A3, by phosphorylation which appears to prevent membrane trafficking of SLC12A3. Also inhibits the renal K(+) channel, KCNJ1, via a kinase-independent mechanism by which it induces clearance of the protein from the cell surface by clathrin-dependent endocytosis. WNK4 appears to act as a molecular switch that can vary the balance between NaCl reabsorption and K(+) secretion to maintain integrated homeostasis. Phosphorylates NEDD4L. Interacts with the C-terminal region of KCNJ1. Interacts with WNK1 and WNK3. Expressed in kidney, colon and skin. Activation requires autophosphorylation of Ser- 335. Phosphorylation of Ser-331 also promotes increased activity. Belongs to the protein kinase superfamily. Ser/Thr protein kinase family. WNK subfamily. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Protein kinase, Other; Protein kinase, Ser/Thr (non-receptor); Kinase, protein; EC 2.7.11.1; Other group; Wnk family

Chromosomal Location of Human Ortholog: 17q21-q22

Cellular Component: tight junction; cytoplasm

Molecular Function: protein serine/threonine kinase activity; protein binding; chloride channel inhibitor activity; ATP binding

Biological Process: protein localization; ion homeostasis; regulation of cellular process; ion transport; chloride transport; protein amino acid phosphorylation

Disease: Pseudohypoaldosteronism, Type Iib

Similar Products

Product Notes

The WNK4 wnk4 (Catalog #AAA6139877) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The WNK4 (Serine/threonine-protein Kinase WNK4, Protein Kinase Lysine-deficient 4, Protein Kinase with No Lysine 4, PRKWNK4, PHA2B) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's WNK4 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the WNK4 wnk4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "WNK4, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.