Mouse anti-Human WNK4 Monoclonal Antibody | anti-WNK4 antibody

WNK4 (Serine/threonine-protein Kinase WNK4, Protein Kinase Lysine-deficient 4, Protein Kinase with No Lysine 4, PRKWNK4, PHA2B) (Biotin)

Cat. Num. AAA6145180

• Gene Names: WNK4; PHA2B; PRKWNK4
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: WNK4; Monoclonal Antibody; WNK4 (Serine/threonine-protein Kinase WNK4; Protein Kinase Lysine-deficient 4; Protein Kinase with No Lysine 4; PRKWNK4; PHA2B) (Biotin); EC=2.7.11.1; anti-WNK4 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 1E6
• Specificity: Recognizes human WNK4.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.

• Applicable Applications for anti-WNK4 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa1144-1244 from human WNK4 (NP_115763) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: KHLSEVETLQTLQKKEIEDLYSRLGKQPPPGIVAPAAMLSSRQRRLSKGSFPTSRRNSLQRSEPPGPGIMRRNSLSGSSTGSQEQRASKGVTFAGDVGRM
• Conjugate: Biotin
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.11kD).)

Testing Data

(Detection limit for recombinant GST tagged WNK4 is 0.03ng/ml as a capture antibody.)

Product Categories/Family for anti-WNK4 antibody

Antibodies; Protein Kinases

NCBI and Uniprot Product Information

• NCBI GI #: 34365793
• NCBI GeneID: 65266
• NCBI Accession #: NP_115763.2
• NCBI GenBank Nucleotide #: NM_032387
• UniProt Accession #: Q96J92; Q8N8X3; Q8N8Z2; Q96DT8; Q9BYS5; B0LPI0
• Molecular Weight: 134,739 Da
• NCBI Official Full Name: serine/threonine-protein kinase WNK4
• NCBI Official Synonym Full Names: WNK lysine deficient protein kinase 4
• NCBI Official Symbol: WNK4
• NCBI Official Synonym Symbols: PHA2B; PRKWNK4
• NCBI Protein Information: serine/threonine-protein kinase WNK4; protein kinase with no lysine 4; protein kinase lysine-deficient 4
• UniProt Protein Name: Serine/threonine-protein kinase WNK4
• Protein Family: Serine/threonine-protein kinase
• UniProt Gene Name: WNK4
• UniProt Synonym Gene Names: PRKWNK4
• UniProt Entry Name: WNK4_HUMAN

Uniprot Description

WNK4: Serine/threonine kinase which plays an important role in the regulation of electrolyte homeostasis, cell signaling, survival and proliferation. Acts as an activator and inhibitor of sodium-coupled chloride cotransporters and potassium-coupled chloride cotransporters respectively. Activates SCNN1A, SCNN1B, SCNN1D, SGK1, TRPV5 and TRPV6. Regulates the activity of the thiazide-sensitive Na-Cl cotransporter, SLC12A3, by phosphorylation which appears to prevent membrane trafficking of SLC12A3. Also inhibits the renal K(+) channel, KCNJ1, via a kinase-independent mechanism by which it induces clearance of the protein from the cell surface by clathrin-dependent endocytosis. WNK4 appears to act as a molecular switch that can vary the balance between NaCl reabsorption and K(+) secretion to maintain integrated homeostasis. Phosphorylates NEDD4L. Interacts with the C-terminal region of KCNJ1. Interacts with WNK1 and WNK3. Expressed in kidney, colon and skin. Activation requires autophosphorylation of Ser- 335. Phosphorylation of Ser-331 also promotes increased activity. Belongs to the protein kinase superfamily. Ser/Thr protein kinase family. WNK subfamily. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Protein kinase, Other; Protein kinase, Ser/Thr (non-receptor); Kinase, protein; EC 2.7.11.1; Other group; Wnk family

Chromosomal Location of Human Ortholog: 17q21-q22

Cellular Component: tight junction; cytoplasm

Molecular Function: protein serine/threonine kinase activity; protein binding; chloride channel inhibitor activity; ATP binding

Biological Process: protein localization; ion homeostasis; regulation of cellular process; ion transport; chloride transport; protein amino acid phosphorylation

Disease: Pseudohypoaldosteronism, Type Iib