Mouse WDHD1 Monoclonal Antibody | anti-WDHD1 antibody

WDHD1 (WD Repeat and HMG-Box DNA Binding Protein 1, AND-1) (AP)

Cat. Num. AAA6165837

• Gene Names: WDHD1; AND1; CTF4; AND-1; CHTF4
• Applications: Western Blot
• Purity: Purified
• Synonyms: WDHD1; Monoclonal Antibody; WDHD1 (WD Repeat and HMG-Box DNA Binding Protein 1; AND-1) (AP); WD Repeat and HMG-Box DNA Binding Protein 1; AND-1; anti-WDHD1 antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 2F10
• Specificity: Recognizes WDHD1.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).

• Applicable Applications for anti-WDHD1 antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: WDHD1 (NP_009017, 1031aa-1128aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: SNILSDNPDFSDEADIIKEGMIRFRVLSTEERKVWANKAKGETASEGTEAKKRKRVVDESDETENQEEKAKENLNLSKKQKPLDFSTNQKLSAFAFKQ
• Conjugate: AP
• Preparation and Storage: Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged WDHD1 is 0.03 ng/ml as a capture antibody.)

Western Blot (WB)

(Western Blot analysis of WDHD1 expression in transfected 293T cell line by WDHD1 monoclonal antibody (M01), clone 2F10.Lane 1: WDHD1 transfected lysate (Predicted MW: 10.89 KDa).Lane 2: Non-transfected lysate.)

Western Blot (WB)

(WDHD1 monoclonal antibody (M01), clone 2F10. Western Blot analysis of WDHD1 expression in Hela S3 NE.)

Related Product Information for anti-WDHD1 antibody

The protein encoded by this gene contains multiple N-terminal WD40 domains and a C-terminal high mobility group (HMG) box. WD40 domains are found in a variety of eukaryotic proteins and may function as adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly. HMG boxes are found in many eukaryotic proteins involved in chromatin assembly, transcription and replication. Alternative splicing results in two transcript variants encoding different isoforms. [provided by RefSeq]

Product Categories/Family for anti-WDHD1 antibody

Antibodies; Binding Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 5901892
• NCBI GeneID: 11169
• NCBI Accession #: NP_009017
• NCBI GenBank Nucleotide #: NM_007086
• UniProt Accession #: O75717
• Molecular Weight: 126kDa
• NCBI Official Full Name: WD repeat and HMG-box DNA-binding protein 1 isoform 1
• NCBI Official Synonym Full Names: WD repeat and HMG-box DNA binding protein 1
• NCBI Official Symbol: WDHD1
• NCBI Official Synonym Symbols: AND1; CTF4; AND-1; CHTF4
• NCBI Protein Information: WD repeat and HMG-box DNA-binding protein 1
• UniProt Protein Name: WD repeat and HMG-box DNA-binding protein 1
• Protein Family: WD repeat and HMG-box DNA-binding protein
• UniProt Gene Name: WDHD1
• UniProt Synonym Gene Names: AND1; And-1
• UniProt Entry Name: WDHD1_HUMAN

NCBI Description

The protein encoded by this gene contains multiple N-terminal WD40 domains and a C-terminal high mobility group (HMG) box. WD40 domains are found in a variety of eukaryotic proteins and may function as adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly. HMG boxes are found in many eukaryotic proteins involved in chromatin assembly, transcription and replication. Alternative splicing results in two transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008]

Uniprot Description

WDHD1: Acts as a replication initiation factor that brings together the MCM2-7 helicase and the DNA polymerase alpha/primase complex in order to initiate DNA replication.

Protein type: DNA-binding

Chromosomal Location of Human Ortholog: 14q22.2

Cellular Component: nucleoplasm; cytoplasm; chromosome, pericentric region

Molecular Function: protein binding; DNA binding; RNA binding; chromatin binding

Biological Process: RNA processing; regulation of chromosome organization and biogenesis