Mouse anti-Human USP29 Monoclonal Antibody | anti-USP29 antibody

USP29 (Ubiquitin-specific-processing Protease 29, Ubiquitin Carboxyl-terminal Hydrolase 29, Deubiquitinating Enzyme 29, Ubiquitin Thioesterase 29, HOM-TES-84/86)

Cat. Num. AAA646476

• Gene Names: USP29; HOM-TES-84/86
• Reactivity: Human
• Applications: ELISA, Western Blot, Immunohistochemistry
• Purity: Affinity Purified; Purified by Protein A affinity chromatography.
• Synonyms: USP29; Monoclonal Antibody; USP29 (Ubiquitin-specific-processing Protease 29; Ubiquitin Carboxyl-terminal Hydrolase 29; Deubiquitinating Enzyme 29; Ubiquitin Thioesterase 29; HOM-TES-84/86); Anti -USP29 (Ubiquitin-specific-processing Protease 29; anti-USP29 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2b,k
• Clone Number: 1A8
• Specificity: Recognizes human USP29.
• Purity/Purification: Affinity Purified; Purified by Protein A affinity chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2.
• Sequence: KTSFYSICNKPSYQKMPLFMSKSPTHVKKGILENQGGKGQNTLSSDVQTNEDILKEDNPVPNKKYKTDSLKYIQSNRKNPSSLEDLEKDRDLKLGPSFNTNCNGNPNLDE

• Applicable Applications for anti-USP29 antibody: ELISA (EL/EIA), Western Blot (WB), Immunohistochemistry (IHC)
• Application Notes: Suitable for use in ELISA, Western Blot and Immunohistochemistry.; Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 1.2ug/ml
• Immunogen: Partial recombinant corresponding to aa131-241 from human USP29 (NP_065954) with GST tag. MW of the GST tag alone is 26kD.
• Preparation and Storage: May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (38.21kD).)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to USP29 on formalin-fixed paraffin-embedded human testis. [antibody concentration 1.2ug/ml].)

Product Categories/Family for anti-USP29 antibody

Antibodies; Abs to Ubiquitin

NCBI and Uniprot Product Information

• NCBI GI #: 10190742
• NCBI GeneID: 57663
• NCBI Accession #: NP_065954.1
• NCBI GenBank Nucleotide #: NM_020903.2
• UniProt Accession #: Q9HBJ7
• Molecular Weight: 104,156 Da
• NCBI Official Full Name: ubiquitin carboxyl-terminal hydrolase 29
• NCBI Official Synonym Full Names: ubiquitin specific peptidase 29
• NCBI Official Symbol: USP29
• NCBI Official Synonym Symbols: HOM-TES-84/86
• NCBI Protein Information: ubiquitin carboxyl-terminal hydrolase 29; ubiquitin thioesterase 29; deubiquitinating enzyme 29; ubiquitin thiolesterase 29; ubiquitin-specific processing protease; ubiquitin-specific-processing protease 29
• UniProt Protein Name: Ubiquitin carboxyl-terminal hydrolase 29
• Protein Family: Ubiquitin carboxyl-terminal hydrolase
• UniProt Gene Name: USP29
• UniProt Entry Name: UBP29_HUMAN

Uniprot Description

Catalytic activity: Thiol-dependent hydrolysis of ester, thioester, amide, peptide and isopeptide bonds formed by the C-terminal Gly of ubiquitin (a 76-residue protein attached to proteins as an intracellular targeting signal).

Sequence similarities: Belongs to the peptidase C19 family.