Mouse anti-Human USP29 Monoclonal Antibody | anti-USP29 antibody

USP29 (Ubiquitin-specific-processing Protease 29, Ubiquitin Carboxyl-terminal Hydrolase 29, Deubiquitinating Enzyme 29, Ubiquitin Thioesterase 29, HOM-TES-84/86) (HRP)

Cat. Num. AAA6155702

• Gene Names: USP29; HOM-TES-84/86
• Reactivity: Human
• Applications: ELISA, Immunohistochemistry, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: USP29; Monoclonal Antibody; USP29 (Ubiquitin-specific-processing Protease 29; Ubiquitin Carboxyl-terminal Hydrolase 29; Deubiquitinating Enzyme 29; Ubiquitin Thioesterase 29; HOM-TES-84/86) (HRP); EC=3.4.19.12; anti-USP29 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2b,k
• Clone Number: 1A8
• Specificity: Recognizes human USP29.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).

• Applicable Applications for anti-USP29 antibody: ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
• Application Notes: IHC-P: 1.2ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa131-241 from human USP29 (NP_065954) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: KTSFYSICNKPSYQKMPLFMSKSPTHVKKGILENQGGKGQNTLSSDVQTNEDILKEDNPVPNKKYKTDSLKYIQSNRKNPSSLEDLEKDRDLKLGPSFNTNCNGNPNLDE
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (38.21kD).)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to USP29 on formalin-fixed paraffin-embedded human testis. [antibody concentration 1.2ug/ml].)

Product Categories/Family for anti-USP29 antibody

Antibodies; Ubiquitin

NCBI and Uniprot Product Information

• NCBI GI #: 10190742
• NCBI GeneID: 57663
• NCBI Accession #: NP_065954
• NCBI GenBank Nucleotide #: NM_020903
• UniProt Accession #: Q9HBJ7
• Molecular Weight: 104kDa
• NCBI Official Full Name: ubiquitin carboxyl-terminal hydrolase 29
• NCBI Official Synonym Full Names: ubiquitin specific peptidase 29
• NCBI Official Symbol: USP29
• NCBI Official Synonym Symbols: HOM-TES-84/86
• NCBI Protein Information: ubiquitin carboxyl-terminal hydrolase 29
• UniProt Protein Name: Ubiquitin carboxyl-terminal hydrolase 29
• Protein Family: Ubiquitin carboxyl-terminal hydrolase
• UniProt Gene Name: USP29
• UniProt Entry Name: UBP29_HUMAN

Uniprot Description

USP29: Belongs to the peptidase C19 family.

Protein type: Ubiquitin-specific protease; Protease; Ubiquitin conjugating system; EC 3.4.19.12

Chromosomal Location of Human Ortholog: 19q13.43

Cellular Component: nucleus

Molecular Function: cysteine-type endopeptidase activity; ubiquitin-specific protease activity

Biological Process: proteasomal ubiquitin-dependent protein catabolic process; protein deubiquitination