Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human USP21 Monoclonal Antibody | anti-USP21 antibody

USP21 (Ubiquitin Carboxyl-terminal Hydrolase 21, Ubiquitin Thioesterase 21, Ubiquitin-specific-Processing Protease 21, Deubiquitinating Enzyme 21, PP1490, USP23) (MaxLight 650)

Gene Names
USP21; USP16; USP23
Reactivity
Human
Applications
Western Blot
Purity
Purified
Synonyms
USP21; Monoclonal Antibody; USP21 (Ubiquitin Carboxyl-terminal Hydrolase 21; Ubiquitin Thioesterase 21; Ubiquitin-specific-Processing Protease 21; Deubiquitinating Enzyme 21; PP1490; USP23) (MaxLight 650); anti-USP21 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3D10
Specificity
Recognizes human USP21.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight650.
Sequence Length
565
Applicable Applications for anti-USP21 antibody
FLISA, Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant protein corresponding to aa466-566 from human USP21 (NP_036607) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
FSASRGSIKKSSVGVDFPLQRLSLGDFASDKAGSPVYQLYALCNHSGSVHYGHYTALCRCQTGWHVYNDSRVSPVSENQVASSEGYVLFYQLMQEPPRCL
Conjugate
MaxLight650
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-USP21 antibody
USP21 is a ubiquitin-specific protease, an enzyme that removes ubiquitin from ubiquitinated proteins. The encoded protein belongs to the C19 peptidase family, also known as family 2 of ubiquitin carboxyl-terminal hydrolases. This protein has been reported to be capable of removing NEDD8 from NEDD8 conjugates.
Product Categories/Family for anti-USP21 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
ubiquitin carboxyl-terminal hydrolase 21 isoform c
NCBI Official Synonym Full Names
ubiquitin specific peptidase 21
NCBI Official Symbol
USP21
NCBI Official Synonym Symbols
USP16; USP23
NCBI Protein Information
ubiquitin carboxyl-terminal hydrolase 21
UniProt Protein Name
Ubiquitin carboxyl-terminal hydrolase 21
UniProt Gene Name
USP21
UniProt Synonym Gene Names
USP23
UniProt Entry Name
UBP21_HUMAN

NCBI Description

This gene encodes a member of the C19 peptidase family, also known as family 2 of ubiquitin carboxy-terminal hydrolases. The encoded protein cleaves ubiquitin from ubiquitinated proteins for recycling in intracellular protein degradation. The encoded protein is also able to release NEDD8, a ubiquitin-like protein, from NEDD8-conjugated proteins. This gene has been referred to as USP16 and USP23 but is now known as USP21. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Feb 2016]

Uniprot Description

USP21: Deubiquitinates histone H2A, a specific tag for epigenetic transcriptional repression, thereby acting as a coactivator. Deubiquitination of histone H2A releaves the repression of di- and trimethylation of histone H3 at 'Lys-4', resulting in regulation of transcriptional initiation. Regulates gene expression via histone H2A deubiquitination. Also capable of removing NEDD8 from NEDD8 conjugates but has no effect on Sentrin-1 conjugates. Belongs to the peptidase C19 family. USP21 subfamily. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Ubiquitin conjugating system; Protease; EC 3.4.19.12; Ubiquitin-specific protease

Chromosomal Location of Human Ortholog: 1q22

Cellular Component: cytoplasm; nucleoplasm; plasma membrane

Molecular Function: cysteine-type peptidase activity; metal ion binding; NEDD8-specific protease activity; protein binding; transcription coactivator activity; ubiquitin-specific protease activity

Biological Process: histone deubiquitination; neurite development; positive regulation of transcription, DNA-dependent; transcription, DNA-dependent; ubiquitin-dependent protein catabolic process

Research Articles on USP21

Similar Products

Product Notes

The USP21 usp21 (Catalog #AAA6220458) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The USP21 (Ubiquitin Carboxyl-terminal Hydrolase 21, Ubiquitin Thioesterase 21, Ubiquitin-specific-Processing Protease 21, Deubiquitinating Enzyme 21, PP1490, USP23) (MaxLight 650) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's USP21 can be used in a range of immunoassay formats including, but not limited to, FLISA, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the USP21 usp21 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "USP21, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.