Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human Urokinase Monoclonal Antibody | anti-uPA antibody

Urokinase (Urokinase-type Plasminogen Activator, U-plasminogen Activator, uPA, PLAU) (MaxLight 405)

Gene Names
PLAU; ATF; QPD; UPA; URK; u-PA; BDPLT5
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
Urokinase; Monoclonal Antibody; Urokinase (Urokinase-type Plasminogen Activator; U-plasminogen Activator; uPA; PLAU) (MaxLight 405); anti-uPA antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
3B8
Specificity
Recognizes human PLAU.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight405.
Applicable Applications for anti-uPA antibody
FLISA, Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa16-115 from human PLAU (AAH13575) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
SDSKGSNELHQVPSNCDCLNGGTCVSNKYFSNIHWCNCPKKFGGQHCEIDKSKTCYEGNGHFYRGKASTDTMGRPCLPWNSATVLQQTYHAHRSDALQLG
Conjugate
MaxLight405
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight405 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-uPA antibody
Urokinase is a serine protease involved in degradation of the extracellular matrix and possibly tumor cell migration and proliferation. A specific polymorphism in the Urokinase gene may be associated with late onset Alzheimer disease and also with decreased affinity for fibrin binding. This protein converts plasminogen to plasmin by specific cleavage of an Arg Val bond in plasminogen. The proprotein is cleaved at a Lys Ile bond by plasmin to form a two chain derivative in which a single disulfide bond connects the amino terminal A chain to the catalytically active, carboxy terminal B chain. This two chain derivative is also called HMW uPA (high molecular weight uPA). HMW uPA can be further processed into LMW uPA (low molecular weight uPA) by cleavage of chain A into a short chain A (A1) and an amino terminal fragment. LMW uPA is proteolytically active but does not bind to the uPA receptor.
Product Categories/Family for anti-uPA antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
46,908 Da
NCBI Official Full Name
Homo sapiens plasminogen activator, urokinase, mRNA
NCBI Official Synonym Full Names
plasminogen activator, urokinase
NCBI Official Symbol
PLAU
NCBI Official Synonym Symbols
ATF; QPD; UPA; URK; u-PA; BDPLT5
NCBI Protein Information
urokinase-type plasminogen activator

NCBI Description

This gene encodes a secreted serine protease that converts plasminogen to plasmin. The encoded preproprotein is proteolytically processed to generate A and B polypeptide chains. These chains associate via a single disulfide bond to form the catalytically inactive high molecular weight urokinase-type plasminogen activator (HMW-uPA). HMW-uPA can be further processed into the catalytically active low molecular weight urokinase-type plasminogen activator (LMW-uPA). This low molecular weight form does not bind to the urokinase-type plasminogen activator receptor. Mutations in this gene may be associated with Quebec platelet disorder and late-onset Alzheimer's disease. Alternative splicing results in multiple transcript variants, at least one of which encodes an isoform that is proteolytically processed. [provided by RefSeq, Jan 2016]

Research Articles on uPA

Similar Products

Product Notes

The uPA (Catalog #AAA6193343) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The Urokinase (Urokinase-type Plasminogen Activator, U-plasminogen Activator, uPA, PLAU) (MaxLight 405) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's Urokinase can be used in a range of immunoassay formats including, but not limited to, FLISA, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the uPA for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Urokinase, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.