Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (38.21kD).)

Mouse anti-Human UGT1A9 Monoclonal Antibody | anti-UGT1A9 antibody

UGT1A9 (UDP-glucuronosyltransferase 1A9, UDP-glucuronosyltransferase 1-9, UDPGT 1-9, UGT1*9, UGT1-09, UGT1.9, UDP-glucuronosyltransferase 1-I, UGT-1I, UGT1I, GNT1, lugP4, UGT1) (PE)

Gene Names
UGT1A9; LUGP4; UDPGT; UGT1I; HLUGP4; UGT-1I; UGT1-9; UGT1.9; UGT1AI; UGT1-09; UGT1A9S; UDPGT 1-9
Reactivity
Human
Applications
ELISA, Immunoprecipitation, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
UGT1A9; Monoclonal Antibody; UGT1A9 (UDP-glucuronosyltransferase 1A9; UDP-glucuronosyltransferase 1-9; UDPGT 1-9; UGT1*9; UGT1-09; UGT1.9; UDP-glucuronosyltransferase 1-I; UGT-1I; UGT1I; GNT1; lugP4; UGT1) (PE); EC=2.4.1.17; HLUGP4; UDPGT; UGT1-9; UGT1AI; anti-UGT1A9 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1A2
Specificity
Recognizes human UGT1A9.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-UGT1A9 antibody
ELISA (EIA), Immunoprecipitation (IP), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa27-137 from human UGT1A9 (NP_066307) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
KLLVVPMDGSHWFTMRSVVEKLILRGHEVVVVMPEVSWQLGRSLNCTVKTYSTSYTLEDLDREFKAFAHAQWKAQVRSIYSLLMGSYNDIFDLFFSNCRSLFKDKKLVEY
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (38.21kD).)

Western Blot (WB) (Western Blot detection against Immunogen (38.21kD).)

Immunoprecipitation (IP)

(Immunoprecipitation of UGT1A9 transfected lysate using UGT1A9 monoclonal antibody and Protein A Magnetic Bead and immunoblotted with UGT1A9 rabbit polyclonal antibody)

Immunoprecipitation (IP) (Immunoprecipitation of UGT1A9 transfected lysate using UGT1A9 monoclonal antibody and Protein A Magnetic Bead and immunoblotted with UGT1A9 rabbit polyclonal antibody)
Product Categories/Family for anti-UGT1A9 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
57kDa
NCBI Official Full Name
UDP-glucuronosyltransferase 1-9
NCBI Official Synonym Full Names
UDP glucuronosyltransferase family 1 member A9
NCBI Official Symbol
UGT1A9
NCBI Official Synonym Symbols
LUGP4; UDPGT; UGT1I; HLUGP4; UGT-1I; UGT1-9; UGT1.9; UGT1AI; UGT1-09; UGT1A9S; UDPGT 1-9
NCBI Protein Information
UDP-glucuronosyltransferase 1-9
UniProt Protein Name
UDP-glucuronosyltransferase 1-9
UniProt Gene Name
UGT1A9
UniProt Synonym Gene Names
GNT1; UGT1; UDPGT 1-9; UGT1*9; UGT1-09; UGT1.9; UGT-1I; UGT1I
UniProt Entry Name
UD19_HUMAN

NCBI Description

This gene encodes a UDP-glucuronosyltransferase, an enzyme of the glucuronidation pathway that transforms small lipophilic molecules, such as steroids, bilirubin, hormones, and drugs, into water-soluble, excretable metabolites. This gene is part of a complex locus that encodes several UDP-glucuronosyltransferases. The locus includes thirteen unique alternate first exons followed by four common exons. Four of the alternate first exons are considered pseudogenes. Each of the remaining nine 5' exons may be spliced to the four common exons, resulting in nine proteins with different N-termini and identical C-termini. Each first exon encodes the substrate binding site, and is regulated by its own promoter. The enzyme encoded by this gene is active on phenols. [provided by RefSeq, Jul 2008]

Uniprot Description

UGT1A9: UDPGT is of major importance in the conjugation and subsequent elimination of potentially toxic xenobiotics and endogenous compounds. This isoform has specificity for phenols. Belongs to the UDP-glycosyltransferase family. 1 isoforms of the human protein are produced by alternative splicing.

Protein type: Endoplasmic reticulum; Transferase; Xenobiotic Metabolism - metabolism by cytochrome P450; Xenobiotic Metabolism - drug metabolism - cytochrome P450; Cofactor and Vitamin Metabolism - porphyrin and chlorophyll; Carbohydrate Metabolism - starch and sucrose; Lipid Metabolism - androgen and estrogen; Xenobiotic Metabolism - drug metabolism - other enzymes; EC 2.4.1.17; Carbohydrate Metabolism - pentose and glucuronate interconversions; Membrane protein, integral; Carbohydrate Metabolism - ascorbate and aldarate; Cofactor and Vitamin Metabolism - retinol

Chromosomal Location of Human Ortholog: 2q37

Cellular Component: endoplasmic reticulum membrane; endoplasmic reticulum; integral to membrane

Molecular Function: enzyme inhibitor activity; protein homodimerization activity; enzyme binding; retinoic acid binding; protein heterodimerization activity; glucuronosyltransferase activity

Biological Process: negative regulation of transferase activity; flavonoid biosynthetic process; metabolic process; xenobiotic metabolic process; flavone metabolic process; retinoic acid metabolic process; cellular lipid metabolic process; negative regulation of fatty acid metabolic process; drug metabolic process; cellular response to hormone stimulus

Research Articles on UGT1A9

Similar Products

Product Notes

The UGT1A9 ugt1a9 (Catalog #AAA6160970) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The UGT1A9 (UDP-glucuronosyltransferase 1A9, UDP-glucuronosyltransferase 1-9, UDPGT 1-9, UGT1*9, UGT1-09, UGT1.9, UDP-glucuronosyltransferase 1-I, UGT-1I, UGT1I, GNT1, lugP4, UGT1) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's UGT1A9 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunoprecipitation (IP), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the UGT1A9 ugt1a9 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "UGT1A9, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.