Mouse anti-Human UPP1 Monoclonal Antibody | anti-UPP1 antibody

UPP1 (Uridine Phosphorylase 1, UP, UPASE, UPase 1, UPP, UrdPase 1, UDRPASE) (Biotin)

Cat. Num. AAA6145083

• Gene Names: UPP1; UP; UPP; UPASE; UDRPASE
• Reactivity: Human
• Applications: ELISA, Immunohistochemistry, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: UPP1; Monoclonal Antibody; UPP1 (Uridine Phosphorylase 1; UP; UPASE; UPase 1; UPP; UrdPase 1; UDRPASE) (Biotin); EC=2.4.2.3; anti-UPP1 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 2F5
• Specificity: Recognizes human UPP1.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.

• Applicable Applications for anti-UPP1 antibody: ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
• Application Notes: IHC-P: 3ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa1-92 from human UPP1 (NP_003355) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MAATGANAEKAESHNDCPVRLLNPNIAKMKEDILYHFNLTTSRHNFPALFGDVKFVCVGGSPSRMKAFIRCVGAELGLDCPGRDYPNICAGT
• Conjugate: Biotin
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Immunoperoxidase of monoclonal antibody to UPP1 on formalin-fixed paraffin-embedded human kidney. [antibody concentration 3ug/ml])

Product Categories/Family for anti-UPP1 antibody

Antibodies; Enzymes; Phosphorylase

NCBI and Uniprot Product Information

• NCBI GI #: 4507839
• NCBI GeneID: 7378
• NCBI Accession #: NP_003355
• NCBI GenBank Nucleotide #: NM_003364
• UniProt Accession #: Q16831
• Molecular Weight: 34kDa
• NCBI Official Full Name: uridine phosphorylase 1 isoform a
• NCBI Official Synonym Full Names: uridine phosphorylase 1
• NCBI Official Symbol: UPP1
• NCBI Official Synonym Symbols: UP; UPP; UPASE; UDRPASE
• NCBI Protein Information: uridine phosphorylase 1
• UniProt Protein Name: Uridine phosphorylase 1
• Protein Family: Uridine phosphorylase
• UniProt Gene Name: UPP1
• UniProt Synonym Gene Names: UP; UPase 1; UrdPase 1
• UniProt Entry Name: UPP1_HUMAN

NCBI Description

This gene encodes a uridine phosphorylase, an enzyme that catalyzes the reversible phosphorylation of uridine (or 2'- deoxyuridine) to uracil and ribose-1-phosphate (or deoxyribose-1-phosphate). The encoded enzyme functions in the degradation and salvage of pyrimidine ribonucleosides. [provided by RefSeq, Oct 2016]

Uniprot Description

UPP1: Catalyzes the reversible phosphorylytic cleavage of uridine and deoxyuridine to uracil and ribose- or deoxyribose-1- phosphate. The produced molecules are then utilized as carbon and energy sources or in the rescue of pyrimidine bases for nucleotide synthesis. Belongs to the PNP/UDP phosphorylase family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Transferase; EC 2.4.2.3; Xenobiotic Metabolism - drug metabolism - other enzymes; Nucleotide Metabolism - pyrimidine

Chromosomal Location of Human Ortholog: 7p12.3

Cellular Component: cytosol

Molecular Function: uridine phosphorylase activity

Biological Process: cellular response to glucose starvation; pyrimidine nucleoside catabolic process; uridine metabolic process; pyrimidine base metabolic process; nucleobase, nucleoside and nucleotide metabolic process; nucleobase, nucleoside, nucleotide and nucleic acid metabolic process; nucleotide catabolic process; pyrimidine nucleoside salvage