Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to UPP1 on formalin-fixed paraffin-embedded human kidney. [antibody concentration 3ug/ml])

Mouse anti-Human UPP1 Monoclonal Antibody | anti-UPP1 antibody

UPP1 (Uridine Phosphorylase 1, UP, UPASE, UPase 1, UPP, UrdPase 1, UDRPASE)

Gene Names
UPP1; UP; UPP; UPASE; UDRPASE
Reactivity
Human
Applications
ELISA, Western Blot, Immunohistochemistry
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
UPP1; Monoclonal Antibody; UPP1 (Uridine Phosphorylase 1; UP; UPASE; UPase 1; UPP; UrdPase 1; UDRPASE); Anti -UPP1 (Uridine Phosphorylase 1; anti-UPP1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2F5
Specificity
Recognizes human UPP1.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MAATGANAEKAESHNDCPVRLLNPNIAKMKEDILYHFNLTTSRHNFPALFGDVKFVCVGGSPSRMKAFIRCVGAELGLDCPGRDYPNICAGT
Applicable Applications for anti-UPP1 antibody
ELISA (EL/EIA), Western Blot (WB), Immunohistochemistry (IHC)
Application Notes
Suitable for use in ELISA, Western Blot and Immunohistochemistry.
Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml
Immunogen
Partial recombinant corresponding to aa1-92 from human UPP1 (NP_003355) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to UPP1 on formalin-fixed paraffin-embedded human kidney. [antibody concentration 3ug/ml])

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to UPP1 on formalin-fixed paraffin-embedded human kidney. [antibody concentration 3ug/ml])
Product Categories/Family for anti-UPP1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
33,934 Da
NCBI Official Full Name
uridine phosphorylase 1
NCBI Official Synonym Full Names
uridine phosphorylase 1
NCBI Official Symbol
UPP1
NCBI Official Synonym Symbols
UP; UPP; UPASE; UDRPASE
NCBI Protein Information
uridine phosphorylase 1; UPase 1; urdPase 1
UniProt Protein Name
Uridine phosphorylase 1
Protein Family
UniProt Gene Name
UPP1
UniProt Synonym Gene Names
UP; UPase 1; UrdPase 1
UniProt Entry Name
UPP1_HUMAN

NCBI Description

The 2 known types of pyrimidine nucleoside phosphorylases, uridine phosphorylase (UP; EC 2.4.2.3) and thymidine phosphorylase (TP; EC 2.4.2.4), in the presence of orthophosphate, catalyze the reversible phosphorolysis of uridine and thymidine or deoxyuridine, respectively, to free bases and ribose-1-phosphate or deoxyribose-1-phosphate. Pyrimidine nucleoside phosphorylases can add ribose or deoxyribose to pyrimidine bases to form nucleosides that can be incorporated into RNA or DNA (Watanabe and Uchida, 1995 [PubMed 7488099]).[supplied by OMIM, Aug 2009]

Uniprot Description

UPP1: Catalyzes the reversible phosphorylytic cleavage of uridine and deoxyuridine to uracil and ribose- or deoxyribose-1- phosphate. The produced molecules are then utilized as carbon and energy sources or in the rescue of pyrimidine bases for nucleotide synthesis. Belongs to the PNP/UDP phosphorylase family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Nucleotide Metabolism - pyrimidine; Xenobiotic Metabolism - drug metabolism - other enzymes; EC 2.4.2.3; Transferase

Chromosomal Location of Human Ortholog: 7p12.3

Cellular Component: cytosol

Molecular Function: uridine phosphorylase activity

Biological Process: cellular response to glucose starvation; pyrimidine nucleoside catabolic process; uridine metabolic process; pyrimidine base metabolic process; nucleobase, nucleoside and nucleotide metabolic process; nucleobase, nucleoside, nucleotide and nucleic acid metabolic process; nucleotide catabolic process; pyrimidine nucleoside salvage

Research Articles on UPP1

Similar Products

Product Notes

The UPP1 upp1 (Catalog #AAA6004831) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The UPP1 (Uridine Phosphorylase 1, UP, UPASE, UPase 1, UPP, UrdPase 1, UDRPASE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's UPP1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA), Western Blot (WB), Immunohistochemistry (IHC). Suitable for use in ELISA, Western Blot and Immunohistochemistry. Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml. Researchers should empirically determine the suitability of the UPP1 upp1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MAATGANAEK AESHNDCPVR LLNPNIAKMK EDILYHFNLT TSRHNFPALF GDVKFVCVGG SPSRMKAFIR CVGAELGLDC PGRDYPNICA GT. It is sometimes possible for the material contained within the vial of "UPP1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.