Testing Data
(Detection limit for recombinant GST tagged UGT2B7 is 0.1 ng/ml as a capture antibody.)
Mouse UGT2B7 Monoclonal Antibody | anti-UGT2B7 antibody
UGT2B7 (UDP Glucuronosyltransferase 2 Family, Polypeptide B7, UGT2B9) (APC)
Gene Names
UGT2B7; UGT2B9; UDPGTH2; UDPGT2B7; UDPGT 2B9
Applications
Western Blot
Purity
Purified
Synonyms
UGT2B7; Monoclonal Antibody; UGT2B7 (UDP Glucuronosyltransferase 2 Family; Polypeptide B7; UGT2B9) (APC); UDP Glucuronosyltransferase 2 Family; UGT2B9; anti-UGT2B7 antibody
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
8D12
Specificity
Recognizes UGT2B7.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-UGT2B7 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
UGT2B7 (NP_001065, 69aa-157aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
SSALKIEIYPTSLTKTELENFIMQQIKRWSDLPKDTFWLYFSQVQEIMSIFGDITRKFCKDVVSNKKFMKKVQESRFDVIFADAIFPCS
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Testing Data
(Detection limit for recombinant GST tagged UGT2B7 is 0.1 ng/ml as a capture antibody.)
Testing Data
(Detection limit for recombinant GST tagged UGT2B7 is 0.1 ng/ml as a capture antibody.)
Western Blot (WB)
(Western Blot analysis of UGT2B7 expression in transfected 293T cell line by UGT2B7 monoclonal antibody (M02), clone 8D12.Lane 1: UGT2B7 transfected lysate (Predicted MW: 58.19 KDa).Lane 2: Non-transfected lysate.)
Western Blot (WB)
(Western Blot analysis of UGT2B7 expression in transfected 293T cell line by UGT2B7 monoclonal antibody (M02), clone 8D12.Lane 1: UGT2B7 transfected lysate (Predicted MW: 58.19 KDa).Lane 2: Non-transfected lysate.)
Western Blot (WB)
(UGT2B7 monoclonal antibody (M02), clone 8D12. Western Blot analysis of UGT2B7 expression in PC-12.)
Western Blot (WB)
(UGT2B7 monoclonal antibody (M02), clone 8D12. Western Blot analysis of UGT2B7 expression in PC-12.)
Related Product Information for anti-UGT2B7 antibody
The UGTs (EC 2.4.1.17) serve a major role in the conjugation and subsequent elimination of potentially toxic xenobiotics and endogenous compounds. UGT2B7 has unique specificity for 3,4-catechol estrogens and estriol, suggesting that it may play an important role in regulating the level and activity of these potent estrogen metabolites. Its subcellular location is the microsome. [supplied by OMIM]
Product Categories/Family for anti-UGT2B7 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
60,695 Da
NCBI Official Full Name
UDP-glucuronosyltransferase 2B7
NCBI Official Synonym Full Names
UDP glucuronosyltransferase 2 family, polypeptide B7
NCBI Official Symbol
UGT2B7
NCBI Official Synonym Symbols
UGT2B9; UDPGTH2; UDPGT2B7; UDPGT 2B9
NCBI Protein Information
UDP-glucuronosyltransferase 2B7
Protein Family
NCBI Description
The protein encoded by this gene belongs to the UDP-glycosyltransferase (UGT) family. UGTs serve a major role in the conjugation and subsequent elimination of potentially toxic xenobiotics and endogenous compounds. This protein is localized in the microsome membrane, and has unique specificity for 3,4-catechol estrogens and estriol, suggesting that it may play an important role in regulating the level and activity of these potent estrogen metabolites. [provided by RefSeq, Sep 2011]
Research Articles on UGT2B7
Similar Products
Product Notes
The UGT2B7 (Catalog #AAA6170245) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's UGT2B7 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the UGT2B7 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "UGT2B7, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
