Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-PAGE

Aspartate aminotransferase, mitochondrial Recombinant Protein | GOT2 recombinant protein

Recombinant human Aspartate aminotransferase, mitochondrial

Gene Names
GOT2; KAT4; KATIV; mitAAT
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Aspartate aminotransferase; mitochondrial; Recombinant human Aspartate aminotransferase; mitochondrial protein; GOT2 recombinant protein
Ordering
For Research Use Only!
Host
E Coli
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence
WTHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLPSVRKAEAQIAAKNLDKEYLPIGGLAEFCKASAELALGENSEVLKSGRFVTVQTISGTGALRIGASFLQRFFKFSRDVFLPKPTWGNHTPIFRDAGMQLQGYRYYDPKTCGFDFTGAVEDISKIPEQSVLLLHACAHNPTGVDPRPEQWKEIATVVKKRNLFAFFDMAYQGFASGDGDKDAWAVRHFIEQGINVCLCQSYAK
Preparation and Storage
Store at -20 degree C. For extended storage, conserve at -20 or -80 degree C.

SDS-PAGE

SDS-PAGE
Related Product Information for GOT2 recombinant protein
Plays a key role in amino acid metabolism. Important for metabolite exchange between mitochondria and cytosol. Facilitates cellular uptake of long-chain free fatty acids.
References
[1] "Nucleotide sequence and tissue distribution of the human mitochondrial aspartate aminotransferase mRNA."

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
54 KD
NCBI Official Full Name
Homo sapiens glutamic-oxaloacetic transaminase 2, mitochondrial (aspartate aminotransferase 2) (GOT2), nuclear gene encoding mitochondrial protein, mRNA
NCBI Official Synonym Full Names
glutamic-oxaloacetic transaminase 2, mitochondrial (aspartate aminotransferase 2)
NCBI Official Symbol
GOT2
NCBI Official Synonym Symbols
KAT4; KATIV; mitAAT
NCBI Protein Information
aspartate aminotransferase, mitochondrial; FABP-1; FABPpm; mAspAT; transaminase A; fatty acid-binding protein; kynurenine aminotransferase IV; glutamate oxaloacetate transaminase 2; plasma membrane-associated fatty acid-binding protein
UniProt Protein Name
Aspartate aminotransferase, mitochondrial
UniProt Gene Name
GOT2
UniProt Synonym Gene Names
mAspAT; FABP-1; FABPpm
UniProt Entry Name
AATM_HUMAN

NCBI Description

Glutamic-oxaloacetic transaminase is a pyridoxal phosphate-dependent enzyme which exists in cytoplasmic and inner-membrane mitochondrial forms, GOT1 and GOT2, respectively. GOT plays a role in amino acid metabolism and the urea and tricarboxylic acid cycles. The two enzymes are homodimeric and show close homology. [provided by RefSeq, Jul 2008]

Uniprot Description

Function: Plays a key role in amino acid metabolism. Important for metabolite exchange between mitochondria and cytosol. Facilitates cellular uptake of long-chain free fatty acids. Ref.6

Catalytic activity: L-aspartate + 2-oxoglutarate = oxaloacetate + L-glutamate.

Cofactor: Pyridoxal phosphate.

Subunit structure: Homodimer.

Subcellular location: Mitochondrion matrix. Cell membrane. Note: Exposure to alcohol promotes translocation to the cell membrane. Ref.6

Induction: Up-regulated by long-time exposure to alcohol. Ref.6

Miscellaneous: In eukaryotes there are cytoplasmic, mitochondrial and chloroplastic isozymes.

Sequence similarities: Belongs to the class-I pyridoxal-phosphate-dependent aminotransferase family.

Research Articles on GOT2

Similar Products

Product Notes

The GOT2 got2 (Catalog #AAA717285) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: WTHVEMGPPD PILGVTEAFK RDTNSKKMNL GVGAYRDDNG KPYVLPSVRK AEAQIAAKNL DKEYLPIGGL AEFCKASAEL ALGENSEVLK SGRFVTVQTI SGTGALRIGA SFLQRFFKFS RDVFLPKPTW GNHTPIFRDA GMQLQGYRYY DPKTCGFDFT GAVEDISKIP EQSVLLLHAC AHNPTGVDPR PEQWKEIATV VKKRNLFAFF DMAYQGFASG DGDKDAWAVR HFIEQGINVC LCQSYAK. It is sometimes possible for the material contained within the vial of "Aspartate aminotransferase, mitochondrial, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.