Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (34.14kD).)

Mouse anti-Human UBL5 Monoclonal Antibody | anti-UBL5 antibody

UBL5 (Ubiquitin-like Protein 5, HUB1) (HRP)

Gene Names
UBL5; HUB1
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
UBL5; Monoclonal Antibody; UBL5 (Ubiquitin-like Protein 5; HUB1) (HRP); anti-UBL5 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
2F7
Specificity
Recognizes human UBL5.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Applicable Applications for anti-UBL5 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1-74 from human UBL5 (NP_077268) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MIEVVCNDRLGKKVRVKCNTDDTIGDLKKLIAAQTGTRWNKIVLKKWYTIFKDHVSLGDYEIHDGMNLELYYQ
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (34.14kD).)

Western Blot (WB) (Western Blot detection against Immunogen (34.14kD).)
Product Categories/Family for anti-UBL5 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
10.7 kDa (93aa), confirmed by MALDI-TOF
NCBI Official Full Name
ubiquitin-like protein 5
NCBI Official Synonym Full Names
ubiquitin like 5
NCBI Official Symbol
UBL5
NCBI Official Synonym Symbols
HUB1
NCBI Protein Information
ubiquitin-like protein 5
UniProt Protein Name
Ubiquitin-like protein 5
Protein Family
UniProt Gene Name
UBL5
UniProt Entry Name
UBL5_HUMAN

NCBI Description

This gene encodes a member of a group of proteins similar to ubiquitin. The encoded protein is not thought to degrade proteins like ubiquitin but to affect their function through being bound to target proteins by an isopeptide bond. The gene product has been studied as a link to predisposition to obesity based on its expression in Psammomys obesus, the fat sand rat, which is an animal model for obesity studies. Variation in this gene was found to be significantly associated with some metabolic traits (PMID: 15331561) but not associated with childhood obesity (PMID: 19189687). Pseudogenes of this gene are located on chromosomes 3, 5 and 17. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq, Jan 2013]

Uniprot Description

UBL5: a widely expressed and highly conserved protein. Orthologs of UBL5 occur in all characterized eukaryotic genomes. Specifically interacts with CLK4.

Protein type: Ubiquitin-like modifier

Chromosomal Location of Human Ortholog: 19p13.3

Cellular Component: cytoplasm; nucleus

Molecular Function: protein tag; protein binding

Biological Process: nuclear mRNA splicing, via spliceosome; protein modification process

Research Articles on UBL5

Similar Products

Product Notes

The UBL5 ubl5 (Catalog #AAA6155650) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The UBL5 (Ubiquitin-like Protein 5, HUB1) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's UBL5 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the UBL5 ubl5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "UBL5, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.