Mouse anti-Human UBL5 Monoclonal Antibody | anti-UBL5 antibody

UBL5 (Ubiquitin-like Protein 5, HUB1) (Biotin)

Cat. Num. AAA6145044

• Gene Names: UBL5; HUB1
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: UBL5; Monoclonal Antibody; UBL5 (Ubiquitin-like Protein 5; HUB1) (Biotin); anti-UBL5 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 2F7
• Specificity: Recognizes human UBL5.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.

• Applicable Applications for anti-UBL5 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa1-74 from human UBL5 (NP_077268) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MIEVVCNDRLGKKVRVKCNTDDTIGDLKKLIAAQTGTRWNKIVLKKWYTIFKDHVSLGDYEIHDGMNLELYYQ
• Conjugate: Biotin
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (34.14kD).)

Product Categories/Family for anti-UBL5 antibody

Antibodies; Ubiquitin

NCBI and Uniprot Product Information

• NCBI GI #: 13236510
• NCBI GeneID: 59286
• NCBI Accession #: NP_077268
• NCBI GenBank Nucleotide #: NM_024292
• UniProt Accession #: Q9BZL1; Q2NL89
• Molecular Weight: 10.7 kDa (93aa), confirmed by MALDI-TOF
• NCBI Official Full Name: ubiquitin-like protein 5
• NCBI Official Synonym Full Names: ubiquitin like 5
• NCBI Official Symbol: UBL5
• NCBI Official Synonym Symbols: HUB1
• NCBI Protein Information: ubiquitin-like protein 5
• UniProt Protein Name: Ubiquitin-like protein 5
• Protein Family: Ubiquitin-like protein
• UniProt Gene Name: UBL5
• UniProt Entry Name: UBL5_HUMAN

NCBI Description

This gene encodes a member of a group of proteins similar to ubiquitin. The encoded protein is not thought to degrade proteins like ubiquitin but to affect their function through being bound to target proteins by an isopeptide bond. The gene product has been studied as a link to predisposition to obesity based on its expression in Psammomys obesus, the fat sand rat, which is an animal model for obesity studies. Variation in this gene was found to be significantly associated with some metabolic traits (PMID: 15331561) but not associated with childhood obesity (PMID: 19189687). Pseudogenes of this gene are located on chromosomes 3, 5 and 17. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq, Jan 2013]

Uniprot Description

UBL5: a widely expressed and highly conserved protein. Orthologs of UBL5 occur in all characterized eukaryotic genomes. Specifically interacts with CLK4.

Protein type: Ubiquitin-like modifier

Chromosomal Location of Human Ortholog: 19p13.3

Cellular Component: cytoplasm; nucleus

Molecular Function: protein tag; protein binding

Biological Process: nuclear mRNA splicing, via spliceosome; protein modification process