Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (46.24kD).)

Mouse anti-Human UBE2M Monoclonal Antibody | anti-UBE2M antibody

UBE2M (Ubiquitin-conjugating Enzyme E2 M, NEDD8-conjugating Enzyme Ubc12, NEDD8 Carrier Protein, NEDD8 Protein Ligase, UBC12, hUbc12, UBC-RS2)

Reactivity
Human
Applications
ELISA, Western Blot, Immunofluorescence
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
UBE2M; Monoclonal Antibody; UBE2M (Ubiquitin-conjugating Enzyme E2 M; NEDD8-conjugating Enzyme Ubc12; NEDD8 Carrier Protein; NEDD8 Protein Ligase; UBC12; hUbc12; UBC-RS2); Anti -UBE2M (Ubiquitin-conjugating Enzyme E2 M; anti-UBE2M antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
3C4
Specificity
Recognizes human UBE2M.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MIKLFSLKQQKKEEESAGGTKGSSKKASAAQLRIQKDINELNLPKTCDISFSDPDDLLNFKLVICPDEGFYKSGKFVFSFKVGQGYPHDPPKVKCETMVYHPNIDLEGNVCLNILREDWKPVLTINSIIYGLQYLFLEPNPEDPLNKEAAEVLQNNRRLFEQNVQRSMRGGYIGSTYFERCLK
Applicable Applications for anti-UBE2M antibody
ELISA (EL/EIA), Western Blot (WB), Immunofluorescence (IF)
Application Notes
Suitable for use in ELISA, Immunofluorescence and Western Blot.
Dilution: Immunofluorescence: 10ug/ml
Immunogen
Full length recombinant corresponding to aa1-184 from UBE2M (AAH58924) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (46.24kD).)

Western Blot (WB) (Western Blot detection against Immunogen (46.24kD).)

Western Blot (WB)

(UBE2M monoclonal antibody Western Blot analysis of UBE2M expression in Jurkat.)

Western Blot (WB) (UBE2M monoclonal antibody Western Blot analysis of UBE2M expression in Jurkat.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to UBE2M on HeLa cell. [antibody concentration 10ug/ml].)

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to UBE2M on HeLa cell. [antibody concentration 10ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged UBE2M is ~0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged UBE2M is ~0.1ng/ml as a capture antibody.)
Product Categories/Family for anti-UBE2M antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
20,900 Da
NCBI Official Full Name
UBE2M protein
NCBI Official Synonym Full Names
ubiquitin-conjugating enzyme E2M<
NCBI Official Symbol
UBE2M
NCBI Protein Information
NEDD8-conjugating enzyme Ubc12; NEDD8 protein ligase; NEDD8 carrier protein; ubiquitin-conjugating enzyme E2 M; ubiquitin-conjugating enzyme E2M (UBC12 homolog, yeast)
UniProt Protein Name
NEDD8-conjugating enzyme Ubc12
UniProt Gene Name
UBE2M
UniProt Synonym Gene Names
UBC12
UniProt Entry Name
UBC12_BOVIN

Uniprot Description

Function: Accepts the ubiquitin-like protein NEDD8 from the UBA3-NAE1 E1 complex and catalyzes its covalent attachment to other proteins. The specific interaction with the E3 ubiquitin ligase RBX1, but not RBX2, suggests that the RBX1-UBE2M complex neddylates specific target proteins, such as CUL1, CUL2, CUL3 and CUL4. Involved in cell proliferation

By similarity.

Catalytic activity: ATP + NEDD8 + protein lysine = AMP + diphosphate + protein N-NEDD8yllysine.

Pathway: Protein modification; protein neddylation.

Subunit structure: Interacts with UBA3, DCN1L and RBX1

By similarity.

Domain: Both the N-terminal docking peptide and the catalytic core domain must bind the UBA3-NAE1 complex simultaneously for optimal transfer of NEDD8

By similarity.

Post-translational modification: The acetylation of Met-1 increases affinity for DCUN1D1 by about 2 orders of magnitude and is crucial for NEDD8 transfer to cullins

By similarity.

Sequence similarities: Belongs to the ubiquitin-conjugating enzyme family. UBC12 subfamily.

Similar Products

Product Notes

The UBE2M ube2m (Catalog #AAA6008360) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The UBE2M (Ubiquitin-conjugating Enzyme E2 M, NEDD8-conjugating Enzyme Ubc12, NEDD8 Carrier Protein, NEDD8 Protein Ligase, UBC12, hUbc12, UBC-RS2) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's UBE2M can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA), Western Blot (WB), Immunofluorescence (IF). Suitable for use in ELISA, Immunofluorescence and Western Blot. Dilution: Immunofluorescence: 10ug/ml. Researchers should empirically determine the suitability of the UBE2M ube2m for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MIKLFSLKQQ KKEEESAGGT KGSSKKASAA QLRIQKDINE LNLPKTCDIS FSDPDDLLNF KLVICPDEGF YKSGKFVFSF KVGQGYPHDP PKVKCETMVY HPNIDLEGNV CLNILREDWK PVLTINSIIY GLQYLFLEPN PEDPLNKEAA EVLQNNRRLF EQNVQRSMRG GYIGSTYFER CLK. It is sometimes possible for the material contained within the vial of "UBE2M, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.