Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (UBE2H monoclonal antibody, Western Blot analysis of UBE2H expression in HeLa.)

Mouse anti-Human UBE2H Monoclonal Antibody | anti-UBE2H antibody

UBE2H (Ubiquitin-conjugating Enzyme E2 H, UbcH2, Ubiquitin Carrier Protein H, UBCH, Ubiquitin-conjugating Enzyme E2-20K, Ubiquitin-protein Ligase H)

Gene Names
UBE2H; GID3; UBC8; UBCH; UBCH2; E2-20K
Reactivity
Human
Applications
ELISA, Western Blot, Immunofluorescence
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
UBE2H; Monoclonal Antibody; UBE2H (Ubiquitin-conjugating Enzyme E2 H; UbcH2; Ubiquitin Carrier Protein H; UBCH; Ubiquitin-conjugating Enzyme E2-20K; Ubiquitin-protein Ligase H); Anti -UBE2H (Ubiquitin-conjugating Enzyme E2 H; anti-UBE2H antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3C4-1A2
Specificity
Recognizes human UBE2H.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MSSPSPGKRRMDTDVVKLIESKHEVTILGGLNEFVVKFYGPQGTPYEGGVWKVRVDLPDKYPFKSPSIGFMNKIFHPNIDEASGTVCLDVINQTWTALYDLTNIFESFLPQLLAYPNPIDPLNGDAAAMYLHRPEEYKQKIKEYIQKYATEEALKEQEEGTGDSSSESSMSDFSEDEAQDMEL
Applicable Applications for anti-UBE2H antibody
ELISA (EL/EIA), Western Blot (WB), Immunofluorescence (IF)
Application Notes
Suitable for use in Immunofluorescence, ELISA and Western Blot.
Dilution: Immunofluorescence: 10ug/ml
Immunogen
Full length recombinant corresponding to aa1-183 from human UBE2H (AAH06277) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(UBE2H monoclonal antibody, Western Blot analysis of UBE2H expression in HeLa.)

Western Blot (WB) (UBE2H monoclonal antibody, Western Blot analysis of UBE2H expression in HeLa.)

Western Blot (WB)

(Western Blot analysis of UBE2H expression in transfected 293T cell line by UBE2H monoclonal antibody|Lane 1: UBE2H transfected lysate (20.7kD).|Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of UBE2H expression in transfected 293T cell line by UBE2H monoclonal antibody|Lane 1: UBE2H transfected lysate (20.7kD).|Lane 2: Non-transfected lysate.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to UBE2H on HeLa cell. [antibody concentration 10ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to UBE2H on HeLa cell. [antibody concentration 10ug/ml])

Testing Data

(Detection limit for recombinant GST tagged UBE2H is ~0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged UBE2H is ~0.03ng/ml as a capture antibody.)
Product Categories/Family for anti-UBE2H antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
20,655 Da
NCBI Official Full Name
ubiquitin-conjugating enzyme E2 H isoform 3
NCBI Official Synonym Full Names
ubiquitin-conjugating enzyme E2H
NCBI Official Symbol
UBE2H
NCBI Official Synonym Symbols
GID3; UBC8; UBCH; UBCH2; E2-20K
NCBI Protein Information
ubiquitin-conjugating enzyme E2 H; ubiquitin-protein ligase H; ubiquitin carrier protein H; GID complex subunit 3, UBC8 homolog; ubiquitin-conjugating enzyme E2-20K; ubiquitin-conjugating enzyme E2H (UBC8 homolog, yeast); ubiquitin-conjugating enzyme E2H (homologous to yeast UBC8)
UniProt Protein Name
Ubiquitin-conjugating enzyme E2 H
UniProt Gene Name
UBE2H
UniProt Entry Name
UBE2H_HUMAN

NCBI Description

The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. The encoded protein sequence is 100% identical to the mouse homolog and 98% identical to the frog and zebrafish homologs. Three alternatively spliced transcript variants have been found for this gene and they encode distinct isoforms. [provided by RefSeq, Feb 2011]

Uniprot Description

UBE2H: Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. In vitro catalyzes 'Lys- 11'- and 'Lys-48'-linked polyubiquitination. Capable, in vitro, to ubiquitinate histone H2A. Belongs to the ubiquitin-conjugating enzyme family.

Protein type: Ligase; Ubiquitin ligase; EC 6.3.2.19; Mitochondrial; Ubiquitin conjugating system

Chromosomal Location of Human Ortholog: 7q32

Cellular Component: cytoplasm

Molecular Function: protein binding; small conjugating protein ligase activity; ubiquitin protein ligase binding; ubiquitin-protein ligase activity; ATP binding; ligase activity

Biological Process: ubiquitin-dependent protein catabolic process

Research Articles on UBE2H

Similar Products

Product Notes

The UBE2H ube2h (Catalog #AAA644243) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The UBE2H (Ubiquitin-conjugating Enzyme E2 H, UbcH2, Ubiquitin Carrier Protein H, UBCH, Ubiquitin-conjugating Enzyme E2-20K, Ubiquitin-protein Ligase H) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's UBE2H can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA), Western Blot (WB), Immunofluorescence (IF). Suitable for use in Immunofluorescence, ELISA and Western Blot. Dilution: Immunofluorescence: 10ug/ml. Researchers should empirically determine the suitability of the UBE2H ube2h for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MSSPSPGKRR MDTDVVKLIE SKHEVTILGG LNEFVVKFYG PQGTPYEGGV WKVRVDLPDK YPFKSPSIGF MNKIFHPNID EASGTVCLDV INQTWTALYD LTNIFESFLP QLLAYPNPID PLNGDAAAMY LHRPEEYKQK IKEYIQKYAT EEALKEQEEG TGDSSSESSM SDFSEDEAQD MEL. It is sometimes possible for the material contained within the vial of "UBE2H, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.