Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (TYK2 monoclonal antibody, Western Blot analysis of TYK2 expression in HeLa.)

Mouse anti-Human TYK2 Monoclonal Antibody | anti-TYK2 antibody

TYK2 (Non-receptor Tyrosine-protein Kinase TYK2, JTK1) (Biotin)

Gene Names
TYK2; JTK1; IMD35
Reactivity
Human
Applications
ELISA, Immunofluorescence, Immunohistochemistry, Immunoprecipitation, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
TYK2; Monoclonal Antibody; TYK2 (Non-receptor Tyrosine-protein Kinase TYK2; JTK1) (Biotin); EC=2.7.10.2; anti-TYK2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
6G12
Specificity
Recognizes human TYK2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-TYK2 antibody
ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunoprecipitation (IP), Western Blot (WB)
Application Notes
IF: 10ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa276-375 from human TYK2 (AAH14243) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
PVCHLRLLAQAEGEPCYIRDSGVAPTDPGPESAAGPPTHEVLVTGTGGIQWWPVEEEVNKEEGSSGSSGRNPQASLFGKKAKAHKAFGQPADRPREPLWA
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(TYK2 monoclonal antibody, Western Blot analysis of TYK2 expression in HeLa.)

Western Blot (WB) (TYK2 monoclonal antibody, Western Blot analysis of TYK2 expression in HeLa.)

Western Blot (WB)

(Western Blot analysis of TYK2 expression in transfected 293T cell line by TYK2 monoclonal antibody Lane 1: TYK2 transfected lysate (133.7kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of TYK2 expression in transfected 293T cell line by TYK2 monoclonal antibody Lane 1: TYK2 transfected lysate (133.7kD). Lane 2: Non-transfected lysate.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to TYK2 on formalin-fixed paraffin-embedded human colon. [antibody concentration 3ug/ml])

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to TYK2 on formalin-fixed paraffin-embedded human colon. [antibody concentration 3ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to TYK2 on HeLa cell. [antibody concentration 10ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to TYK2 on HeLa cell. [antibody concentration 10ug/ml])

Immunoprecipitation (IP)

(Immunoprecipitation of TYK2 transfected lysate using TYK2 monoclonal antibody and Protein A Magnetic Bead and immunoblotted with TYK2 rabbit polyclonal antibody.)

Immunoprecipitation (IP) (Immunoprecipitation of TYK2 transfected lysate using TYK2 monoclonal antibody and Protein A Magnetic Bead and immunoblotted with TYK2 rabbit polyclonal antibody.)
Product Categories/Family for anti-TYK2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
133,650 Da
NCBI Official Full Name
Homo sapiens tyrosine kinase 2, mRNA
NCBI Official Synonym Full Names
tyrosine kinase 2
NCBI Official Symbol
TYK2
NCBI Official Synonym Symbols
JTK1; IMD35
NCBI Protein Information
non-receptor tyrosine-protein kinase TYK2

NCBI Description

This gene encodes a member of the tyrosine kinase and, more specifically, the Janus kinases (JAKs) protein families. This protein associates with the cytoplasmic domain of type I and type II cytokine receptors and promulgate cytokine signals by phosphorylating receptor subunits. It is also component of both the type I and type III interferon signaling pathways. As such, it may play a role in anti-viral immunity. A mutation in this gene has been associated with hyperimmunoglobulin E syndrome (HIES) - a primary immunodeficiency characterized by elevated serum immunoglobulin E. [provided by RefSeq, Jul 2008]

Research Articles on TYK2

Similar Products

Product Notes

The TYK2 (Catalog #AAA6145006) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The TYK2 (Non-receptor Tyrosine-protein Kinase TYK2, JTK1) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TYK2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunoprecipitation (IP), Western Blot (WB). IF: 10ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the TYK2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "TYK2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.