Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-PAGE

C-X-C motif chemokine 2 protein Recombinant Protein | CXCL2 recombinant protein

Recombinant mouse C-X-C motif chemokine 2 protein

Gene Names
CXCL2; GRO2; GROb; MIP2; MIP2A; SCYB2; MGSA-b; MIP-2a; CINC-2a
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
C-X-C motif chemokine 2 protein; Recombinant mouse C-X-C motif chemokine 2 protein; CXCL2 recombinant protein
Ordering
For Research Use Only!
Host
E Coli
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence
AVVASELRCQCLKTLPRVDFKNIQSLSVTPPGPHCAQTEVIATLKGGQKVCLDPEAPLVQKIIQKILNKGKAN
Preparation and Storage
Store at -20 degree C. For extended storage, conserve at -20 or -80 degree C.

SDS-PAGE

SDS-PAGE
Related Product Information for CXCL2 recombinant protein
Chemotactic for human polymorphonuclear leukocytes but does not induce chemokinesis or an oxidative burst.
References
[1] "Cloning and characterization of cDNAs for murine macrophage inflammatory protein 2 and its human homologues."

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
15 KD
NCBI Official Full Name
C-X-C motif chemokine 2
NCBI Official Synonym Full Names
chemokine (C-X-C motif) ligand 2
NCBI Official Symbol
CXCL2
NCBI Official Synonym Symbols
GRO2; GROb; MIP2; MIP2A; SCYB2; MGSA-b; MIP-2a; CINC-2a
NCBI Protein Information
C-X-C motif chemokine 2; gro-beta; MGSA beta; MIP2-alpha; GRO2 oncogene; growth-regulated protein beta; macrophage inflammatory protein 2-alpha; melanoma growth stimulatory activity beta
UniProt Protein Name
C-X-C motif chemokine 2
Protein Family
UniProt Gene Name
CXCL2
UniProt Synonym Gene Names
GRO2; GROB; MIP2A; SCYB2; Gro-beta; MIP2-alpha; HSF
UniProt Entry Name
CXCL2_HUMAN

NCBI Description

This antimicrobial gene is part of a chemokine superfamily that encodes secreted proteins involved in immunoregulatory and inflammatory processes. The superfamily is divided into four subfamilies based on the arrangement of the N-terminal cysteine residues of the mature peptide. This chemokine, a member of the CXC subfamily, is expressed at sites of inflammation and may suppress hematopoietic progenitor cell proliferation. [provided by RefSeq, Sep 2014]

Uniprot Description

Function: Produced by activated monocytes and neutrophils and expressed at sites of inflammation. Hematoregulatory chemokine, which, in vitro, suppresses hematopoietic progenitor cell proliferation. GRO-beta(5-73) shows a highly enhanced hematopoietic activity. Ref.9

Subcellular location: Secreted.

Post-translational modification: The N-terminal processed form GRO-beta(5-73) is produced by proteolytic cleavage after secretion from bone marrow stromal cells.

Pharmaceutical use: GRO-beta(5-73) is available under the name Garnocestim as immunomodulator. It is used prior to hematopoietic transplantation for peripheral blood stem cell mobilization and reduction of incidence, duration, and/or severity of chemotherapy induced cytopenias.

Sequence similarities: Belongs to the intercrine alpha (chemokine CxC) family.

Research Articles on CXCL2

Similar Products

Product Notes

The CXCL2 cxcl2 (Catalog #AAA717320) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: AVVASELRCQ CLKTLPRVDF KNIQSLSVTP PGPHCAQTEV IATLKGGQKV CLDPEAPLVQ KIIQKILNKG KAN. It is sometimes possible for the material contained within the vial of "C-X-C motif chemokine 2 protein, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.