Mouse anti-Human TYK2 Monoclonal Antibody | anti-TYK2 antibody

TYK2 (Non-receptor Tyrosine-protein Kinase TYK2, JTK1) (AP)

Cat. Num. AAA6134400

• Gene Names: TYK2; JTK1; IMD35
• Reactivity: Human
• Applications: ELISA, Immunohistochemistry, Immunoprecipitation, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: TYK2; Monoclonal Antibody; TYK2 (Non-receptor Tyrosine-protein Kinase TYK2; JTK1) (AP); EC=2.7.10.2; anti-TYK2 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 6G12
• Specificity: Recognizes human TYK2.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).

• Applicable Applications for anti-TYK2 antibody: ELISA (EIA), Immunohistochemistry (IHC), Immunoprecipitation (IP), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa276-375 from human TYK2 (AAH14243) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: PVCHLRLLAQAEGEPCYIRDSGVAPTDPGPESAAGPPTHEVLVTGTGGIQWWPVEEEVNKEEGSSGSSGRNPQASLFGKKAKAHKAFGQPADRPREPLWA
• Conjugate: AP
• Preparation and Storage: Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(TYK2 monoclonal antibody, Western Blot analysis of TYK2 expression in HeLa.)

Western Blot (WB)

(Western Blot analysis of TYK2 expression in transfected 293T cell line by TYK2 monoclonal antibody Lane 1: TYK2 transfected lysate (133.7kD). Lane 2: Non-transfected lysate.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to TYK2 on formalin-fixed paraffin-embedded human colon. [antibody concentration 3ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to TYK2 on HeLa cell. [antibody concentration 10ug/ml])

Immunoprecipitation (IP)

(Immunoprecipitation of TYK2 transfected lysate using TYK2 monoclonal antibody and Protein A Magnetic Bead and immunoblotted with TYK2 rabbit polyclonal antibody.)

Product Categories/Family for anti-TYK2 antibody

Antibodies; Protein Kinases

NCBI and Uniprot Product Information

• NCBI GI #: 33878411
• NCBI GeneID: 7297
• Molecular Weight: 133,650 Da
• NCBI Official Full Name: Homo sapiens tyrosine kinase 2, mRNA
• NCBI Official Synonym Full Names: tyrosine kinase 2
• NCBI Official Symbol: TYK2
• NCBI Official Synonym Symbols: JTK1; IMD35
• NCBI Protein Information: non-receptor tyrosine-protein kinase TYK2
• Protein Family: Non-receptor tyrosine-protein kinase

NCBI Description

This gene encodes a member of the tyrosine kinase and, more specifically, the Janus kinases (JAKs) protein families. This protein associates with the cytoplasmic domain of type I and type II cytokine receptors and promulgate cytokine signals by phosphorylating receptor subunits. It is also component of both the type I and type III interferon signaling pathways. As such, it may play a role in anti-viral immunity. A mutation in this gene has been associated with hyperimmunoglobulin E syndrome (HIES) - a primary immunodeficiency characterized by elevated serum immunoglobulin E. [provided by RefSeq, Jul 2008]