Mouse anti-Human TXNL4A Monoclonal Antibody | anti-TXNL4A antibody

TXNL4A (Thioredoxin-like Protein 4A, TXNL4, DIB1, DIM1 Protein Homolog, DIM1, Spliceosomal U5 snRNP-specific 15kD Protein, Thioredoxin-like U5 snRNP Protein U5-15kD) APC

Cat. Num. AAA6139700

• Gene Names: TXNL4A; BMKS; DIB1; DIM1; TXNL4; SNRNP15; U5-15kD
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: TXNL4A; Monoclonal Antibody; TXNL4A (Thioredoxin-like Protein 4A; TXNL4; DIB1; DIM1 Protein Homolog; DIM1; Spliceosomal U5 snRNP-specific 15kD Protein; Thioredoxin-like U5 snRNP Protein U5-15kD) APC; HsT161; U5-15kD; anti-TXNL4A antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 1C4
• Specificity: Recognizes human TXNL4A.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).

• Applicable Applications for anti-TXNL4A antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length recombinant corresponding to aa1-142 from human TXNL4A (AAH01046) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MSYMLPHLHNGWQVDQAILSEEDRVVVIRFGHDWDPTCMKMDEVLYSIAEKVKNFAVIYLVDITEVPDFNKMYELYDPCTVMFFFRNKHIMIDLGTGNNNKINWAMEDKQEMVDIIETVYRGARKGRGLVVSPKDYSTKYRY
• Conjugate: APC
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (41.73kD).)

Western Blot (WB)

(Western Blot analysis of TXNL4A expression in transfected 293T cell line by TXNL4A monoclonal antibody Lane 1: TXNL4A transfected lysate (16.8kD). Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged TXNL4A is ~0.1ng/ml as a capture antibody.)

Product Categories/Family for anti-TXNL4A antibody

Antibodies; Thioredoxin

NCBI and Uniprot Product Information

• NCBI GI #: 33875918
• NCBI GeneID: 10907
• Molecular Weight: 16,786 Da
• NCBI Official Full Name: Homo sapiens thioredoxin-like 4A, mRNA
• NCBI Official Synonym Full Names: thioredoxin like 4A
• NCBI Official Symbol: TXNL4A
• NCBI Official Synonym Symbols: BMKS; DIB1; DIM1; TXNL4; SNRNP15; U5-15kD
• NCBI Protein Information: thioredoxin-like protein 4A
• Protein Family: Thioredoxin-like protein

NCBI Description

The protein encoded by this gene is a member of the U5 small ribonucleoprotein particle (snRNP), and is involved in pre-mRNA splicing. This protein contains a thioredoxin-like fold and it is expected to interact with multiple proteins. Protein-protein interactions have been observed with the polyglutamine tract-binding protein 1 (PQBP1). Mutations in both the coding region and promoter region of this gene have been associated with Burn-McKeown syndrome, which is a rare disorder characterized by craniofacial dysmorphisms, cardiac defects, hearing loss, and bilateral choanal atresia. A pseudogene of this gene is found on chromosome 2. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Mar 2015]