Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against immunogen (36.41kD) usingMBS6011262.)

Mouse anti-Human TSPAN32 Monoclonal Antibody | anti-TSPAN32 antibody

TSPAN32 (Tetraspanin-32, Tspan-32, ART1, Protein Phemx, PHEMX, PHMX, TSSC6) (MaxLight 550)

Gene Names
TSPAN32; ART1; PHMX; PHEMX; TSSC6
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
TSPAN32; Monoclonal Antibody; TSPAN32 (Tetraspanin-32; Tspan-32; ART1; Protein Phemx; PHEMX; PHMX; TSSC6) (MaxLight 550); anti-TSPAN32 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
2B4
Specificity
Recognizes human TSPAN32.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight550.
Applicable Applications for anti-TSPAN32 antibody
FLISA, Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant protein corresponding to aa194-290 of human TSPAN32 with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
RCGCSLDRKGKYTLTPRACGRQPQEPSLLRCSQGGPTHCLHSEAVAIGPRGCSGSLRWLQESDAAPLPLSCHLAAHRALQGRSRGGLSGCPERGLSD
Conjugate
MaxLight550
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight550 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against immunogen (36.41kD) usingMBS6011262.)

Western Blot (WB) (Western Blot detection against immunogen (36.41kD) usingMBS6011262.)

Western Blot (WB)

(Western Blot analysis of TSPAN32 expression in Hela NE usingMBS6011262.)

Western Blot (WB) (Western Blot analysis of TSPAN32 expression in Hela NE usingMBS6011262.)

Testing Data

(Detection limit for134824 is ~0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for134824 is ~0.1ng/ml as a capture antibody.)
Related Product Information for anti-TSPAN32 antibody
MaxLight550 is a new Yellow-Green photostable dye conjugate comparable to Alexa Fluor546, 555, DyLight549, Cy3, TRITC and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (550nm); Emission (575nm); Extinction Coefficient 150,000.
Product Categories/Family for anti-TSPAN32 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
NCBI Official Synonym Full Names
tetraspanin 32
NCBI Official Symbol
TSPAN32
NCBI Official Synonym Symbols
ART1; PHMX; PHEMX; TSSC6
NCBI Protein Information
tetraspanin-32
Protein Family

NCBI Description

This gene, which is a member of the tetraspanin superfamily, is one of several tumor-suppressing subtransferable fragments located in the imprinted gene domain of chromosome 11p15.5, an important tumor-suppressor gene region. Alterations in this region have been associated with Beckwith-Wiedemann syndrome, Wilms tumor, rhabdomyosarcoma, adrenocortical carcinoma, and lung, ovarian and breast cancers. This gene is located among several imprinted genes; however, this gene, as well as the tumor-suppressing subchromosomal transferable fragment 4, escapes imprinting. This gene may play a role in malignancies and diseases that involve this region, and it is also involved in hematopoietic cell function. Alternatively spliced transcript variants have been described, but their biological validity has not been determined. [provided by RefSeq, Jul 2008]

Research Articles on TSPAN32

Similar Products

Product Notes

The TSPAN32 (Catalog #AAA6214569) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The TSPAN32 (Tetraspanin-32, Tspan-32, ART1, Protein Phemx, PHEMX, PHMX, TSSC6) (MaxLight 550) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TSPAN32 can be used in a range of immunoassay formats including, but not limited to, FLISA, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the TSPAN32 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "TSPAN32, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.