Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37kD).)

Mouse anti-Human TSHZ1 Monoclonal Antibody | anti-TSHZ1 antibody

TSHZ1 (Teashirt Homolog 1, TSH1, Antigen NY-CO-33, CAA, Serologically Defined Colon Cancer Antigen 33, SDCCAG33) APC

Gene Names
TSHZ1; CAA; TSH1; NY-CO-33; SDCCAG33
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
TSHZ1; Monoclonal Antibody; TSHZ1 (Teashirt Homolog 1; TSH1; Antigen NY-CO-33; CAA; Serologically Defined Colon Cancer Antigen 33; SDCCAG33) APC; anti-TSHZ1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
2F1
Specificity
Recognizes human SDCCAG33.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Sequence Length
4944
Applicable Applications for anti-TSHZ1 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa619-717 from SDCCAG33 (NP_005777) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
SSLAKAASPIAKENKDFPKTEEVSGKPQKKGPEAETGKAKKEGPLDVHTPNGTEPLKAKVTNGCNNLGIIMDHSPEPSFINPLSALQSIMNTHLGKVSK
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37kD).)

Western Blot (WB)

(Western Blot analysis of TSHZ1 expression in transfected 293T cell line by SDCCAG33 monoclonal antibody)

Western Blot (WB) (Western Blot analysis of TSHZ1 expression in transfected 293T cell line by SDCCAG33 monoclonal antibody)

Testing Data

(Detection limit for recombinant GST tagged TSHZ1 is 0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged TSHZ1 is 0.3ng/ml as a capture antibody.)
Product Categories/Family for anti-TSHZ1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
NCBI Official Full Name
Homo sapiens teashirt zinc finger homeobox 1 (TSHZ1), transcript variant 2, mRNA
NCBI Official Synonym Full Names
teashirt zinc finger homeobox 1
NCBI Official Symbol
TSHZ1
NCBI Official Synonym Symbols
CAA; TSH1; NY-CO-33; SDCCAG33
NCBI Protein Information
teashirt homolog 1
Protein Family

NCBI Description

This gene encodes a colon cancer antigen that was defined by serological analysis of recombinant cDNA expression libraries. The encoded protein is a member of the teashirt C2H2-type zinc-finger protein family and may be involved in transcriptional regulation of developmental processes. Mutations in this gene may be associated with congenital aural atresia syndrome. [provided by RefSeq, Jan 2012]

Research Articles on TSHZ1

Similar Products

Product Notes

The TSHZ1 (Catalog #AAA6138949) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The TSHZ1 (Teashirt Homolog 1, TSH1, Antigen NY-CO-33, CAA, Serologically Defined Colon Cancer Antigen 33, SDCCAG33) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TSHZ1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the TSHZ1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "TSHZ1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.