Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse TRPC5 Monoclonal Antibody | anti-TRPC5 antibody

TRPC5 (Transient Receptor Potential Cation Channel, Subfamily C, Member 5, TRP5) (MaxLight 650)

Gene Names
TRPC5; TRP5; PPP1R159
Applications
Western Blot
Purity
Purified
Synonyms
TRPC5; Monoclonal Antibody; TRPC5 (Transient Receptor Potential Cation Channel; Subfamily C; Member 5; TRP5) (MaxLight 650); Transient Receptor Potential Cation Channel; TRP5; anti-TRPC5 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1C8
Specificity
Recognizes TRPC5.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight650.
Sequence Length
973
Applicable Applications for anti-TRPC5 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
TRPC5 (NP_036603, 534aa-603aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
GLNQLYFYYETRAIDEPNNCKGIRCEKQNNAFSTLFETLQSLFWSVFGLLNLYVTNVKARHEFTEFVGAT
Conjugate
MaxLight650
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-TRPC5 antibody
Mouse monoclonal antibody raised against a partial recombinant TRPC5.
Product Categories/Family for anti-TRPC5 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
short transient receptor potential channel 5
NCBI Official Synonym Full Names
transient receptor potential cation channel subfamily C member 5
NCBI Official Symbol
TRPC5
NCBI Official Synonym Symbols
TRP5; PPP1R159
NCBI Protein Information
short transient receptor potential channel 5
UniProt Protein Name
Short transient receptor potential channel 5
UniProt Gene Name
TRPC5
UniProt Synonym Gene Names
TRP5; TrpC5; TRP-5; hTRP-5; hTRP5
UniProt Entry Name
TRPC5_HUMAN

NCBI Description

This gene belongs to the transient receptor family. It encodes one of the seven mammalian TRPC (transient receptor potential channel) proteins. The encoded protein is a multi-pass membrane protein and is thought to form a receptor-activated non-selective calcium permeant cation channel. The protein is active alone or as a heteromultimeric assembly with TRPC1, TRPC3, and TRPC4. It also interacts with multiple proteins including calmodulin, CABP1, enkurin, Na(+)-H+ exchange regulatory factor (NHERF ), interferon-induced GTP-binding protein (MX1), ring finger protein 24 (RNF24), and SEC14 domain and spectrin repeat-containing protein 1 (SESTD1). [provided by RefSeq, May 2010]

Uniprot Description

TRPC5: Thought to form a receptor-activated non-selective calcium permeant cation channel. Probably is operated by a phosphatidylinositol second messenger system activated by receptor tyrosine kinases or G-protein coupled receptors. Has also been shown to be calcium-selective. May also be activated by intracellular calcium store depletion. Belongs to the transient receptor (TC 1.A.4) family. STrpC subfamily. TRPC5 sub-subfamily.

Protein type: Channel, cation; Membrane protein, integral; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: Xq23

Cellular Component: integral to plasma membrane; plasma membrane

Molecular Function: calcium channel activity; protein binding; store-operated calcium channel activity

Biological Process: calcium ion transport; cytosolic calcium ion homeostasis; manganese ion transport; nervous system development

Research Articles on TRPC5

Similar Products

Product Notes

The TRPC5 trpc5 (Catalog #AAA6230508) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's TRPC5 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the TRPC5 trpc5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "TRPC5, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.