Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot-EBF3 Polyclonal Antibody)

Rabbit anti-Human EBF3 Polyclonal Antibody | anti-EBF3 antibody

EBF3 Polyclonal Antibody

Gene Names
EBF3; COE3; OE-2; EBF-3; HADDS; O/E-2
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purification
Synonyms
EBF3; Polyclonal Antibody; EBF3 Polyclonal Antibody; COE3; EBF-3; HADDS; O/E-2; OE-2; early B-cell factor 3; anti-EBF3 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Concentration
1.39 mg/ml (varies by lot)
Sequence Length
551
Applicable Applications for anti-EBF3 antibody
Western Blot (WB)
Application Notes
WB: 1:500-1:2000
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 400-500 of human EBF3 (NP_001005463.1).
Immunogen Sequence
AEALYSVPRNHNQIPTLGNNPAHTGMMGVNSFSSQLAVNVSETSQANDQVGYSRNTSSVSPRGYVPSSTPQQSNYNTVSTSMNGYGSGAMASLGVPGSPGF
Positive Samples
U-251MG, SH-SY5Y
Cellular Location
Nucleus
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

Western Blot (WB)

(Western blot-EBF3 Polyclonal Antibody)

Western Blot (WB) (Western blot-EBF3 Polyclonal Antibody)
Related Product Information for anti-EBF3 antibody
This gene encodes a member of the early B-cell factor (EBF) family of DNA binding transcription factors. EBF proteins are involved in B-cell differentiation, bone development and neurogenesis, and may also function as tumor suppressors. The encoded protein inhibits cell survival through the regulation of genes involved in cell cycle arrest and apoptosis, and aberrant methylation or deletion of this gene may play a role in multiple malignancies including glioblastoma multiforme and gastric carcinoma.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated: 60kDa; 64kDa
Observed: 58kDa
NCBI Official Full Name
transcription factor COE3
NCBI Official Synonym Full Names
EBF transcription factor 3
NCBI Official Symbol
EBF3
NCBI Official Synonym Symbols
COE3; OE-2; EBF-3; HADDS; O/E-2
NCBI Protein Information
transcription factor COE3
UniProt Protein Name
Transcription factor COE3
Protein Family
UniProt Gene Name
EBF3
UniProt Synonym Gene Names
COE3; EBF-3; O/E-2; OE-2
UniProt Entry Name
COE3_HUMAN

NCBI Description

This gene encodes a member of the early B-cell factor (EBF) family of DNA binding transcription factors. EBF proteins are involved in B-cell differentiation, bone development and neurogenesis, and may also function as tumor suppressors. The encoded protein inhibits cell survival through the regulation of genes involved in cell cycle arrest and apoptosis, and aberrant methylation or deletion of this gene may play a role in multiple malignancies including glioblastoma multiforme and gastric carcinoma. [provided by RefSeq, Sep 2011]

Uniprot Description

EBF3: Transcriptional activator which recognizes variations of the palindromic sequence 5'-ATTCCCNNGGGAATT-3'. Belongs to the COE family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: DNA-binding; Transcription factor

Chromosomal Location of Human Ortholog: 10q26.3

Cellular Component: nucleus

Molecular Function: protein dimerization activity; DNA binding; metal ion binding

Biological Process: transcription, DNA-dependent; positive regulation of transcription, DNA-dependent; multicellular organismal development

Research Articles on EBF3

Similar Products

Product Notes

The EBF3 ebf3 (Catalog #AAA9140662) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The EBF3 Polyclonal Antibody reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's EBF3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500-1:2000. Researchers should empirically determine the suitability of the EBF3 ebf3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "EBF3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.