Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (70.66kD).)

Mouse anti-Human TRNT1 Monoclonal Antibody | anti-TRNT1 antibody

TRNT1 (CCA tRNA Nucleotidyltransferase 1, Mitochondrial, CCA1, Mitochondrial tRNA Nucleotidyl Transferase, CCA-adding, mt CCA-adding Enzyme, MtCCA, mt tRNA CCA-diphosphorylase, mt tRNA CCA-pyrophosphorylase, mt tRNA Adenylyltransferase, CGI-47) APC

Gene Names
TRNT1; CCA1; RPEM; SIFD; MtCCA; CGI-47
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
TRNT1; Monoclonal Antibody; TRNT1 (CCA tRNA Nucleotidyltransferase 1; Mitochondrial; CCA1; Mitochondrial tRNA Nucleotidyl Transferase; CCA-adding; mt CCA-adding Enzyme; MtCCA; mt tRNA CCA-diphosphorylase; mt tRNA CCA-pyrophosphorylase; mt tRNA Adenylyltransferase; CGI-47) APC; EC=2.7.7.72; anti-TRNT1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
1G11
Specificity
Recognizes human TRNT1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-TRNT1 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to aa1-406 from human TRNT1 (AAH12537) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MKLQSPEFQSLFTEGLKSLTELFVKENHELRIAGGAVRDLLNGVKPQDIDFATTATPTQMKEMFQSAGIRMINNRGEKHGTITARLHEENFEITTLRIDVTTDGRHAEVEFTTDWQKDAERRDLTINSMFLGFDGTLFDYFNGYEDLKNKKVRFVGHAKQRIQEDYLRILRYFRFYGRIVDKPGDHDPETLEAIAENAKGLAGISGERIWVELKKILVGNHVNHLIHLIYDLDVAPYIGLPANASLEEFDKVSKNVDGFSPKPVTLLASLFKVQDDVTKLDLRLKIAKEEKNLGLFIVKNRKDLIKATDSSDPLKPYQDFIIDSREPDATTRVCELLKYQGEHCLLKEMQQWSIPPFPVSGHDIRKVGISSGKEIGALLQQLREQWKKSGYQMEKDELLSYIKKT
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (70.66kD).)

Western Blot (WB) (Western Blot detection against Immunogen (70.66kD).)

Western Blot (WB)

(Western Blot analysis of TRNT1 expression in transfected 293T cell line by TRNT1 monoclonal antibody. Lane 1: TRNT1 transfected lysate (46.4kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of TRNT1 expression in transfected 293T cell line by TRNT1 monoclonal antibody. Lane 1: TRNT1 transfected lysate (46.4kD). Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged TRNT1 is 0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged TRNT1 is 0.3ng/ml as a capture antibody.)
Product Categories/Family for anti-TRNT1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
6,937 Da
NCBI Official Full Name
Homo sapiens tRNA nucleotidyl transferase, CCA-adding, 1, mRNA
NCBI Official Synonym Full Names
tRNA nucleotidyl transferase 1
NCBI Official Symbol
TRNT1
NCBI Official Synonym Symbols
CCA1; RPEM; SIFD; MtCCA; CGI-47
NCBI Protein Information
CCA tRNA nucleotidyltransferase 1, mitochondrial

NCBI Description

The protein encoded by this gene is a CCA-adding enzyme which belongs to the tRNA nucleotidyltransferase/poly(A) polymerase family. This essential enzyme functions by catalyzing the addition of the conserved nucleotide triplet CCA to the 3' terminus of tRNA molecules. Mutations in this gene result in sideroblastic anemia with B-cell immunodeficiency, periodic fevers, and developmental delay. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Dec 2014]

Research Articles on TRNT1

Similar Products

Product Notes

The TRNT1 (Catalog #AAA6139639) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The TRNT1 (CCA tRNA Nucleotidyltransferase 1, Mitochondrial, CCA1, Mitochondrial tRNA Nucleotidyl Transferase, CCA-adding, mt CCA-adding Enzyme, MtCCA, mt tRNA CCA-diphosphorylase, mt tRNA CCA-pyrophosphorylase, mt tRNA Adenylyltransferase, CGI-47) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TRNT1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the TRNT1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "TRNT1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.