Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.84kD).)

Mouse NKX3-1 Monoclonal Antibody | anti-NKX3-1 antibody

NKX3-1 (Homeobox Protein Nkx-3.1, Homeobox Protein NK-3 Homolog A, NKX3.1, NKX3A) (Biotin)

Gene Names
NKX3-1; NKX3; BAPX2; NKX3A; NKX3.1
Reactivity
Human, Mouse, Rat
Applications
ELISA, Immunofluorescence, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
NKX3-1; Monoclonal Antibody; NKX3-1 (Homeobox Protein Nkx-3.1; Homeobox Protein NK-3 Homolog A; NKX3.1; NKX3A) (Biotin); anti-NKX3-1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human, Mouse, Rat
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1C7
Specificity
Recognizes human NKX3-1. Species Crossreactivity: mouse and rat.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-NKX3-1 antibody
ELISA (EIA), Immunofluorescence (IF), Western Blot (WB)
Application Notes
IF: 10ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa100-210 from human NKX3-1 (NP_006158) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
GSYLLDSENTSGALPRLPQTPKQPQKRSRAAFSHTQVIELERKFSHQKYLSAPERAHLAKNLKLTETQVKIWFQNRRYKTKRKQLSSELGDLEKHSSLPALKEEAFSRAS
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.84kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.84kD).)

Western Blot (WB)

(NKX3-1 monoclonal antibody. Western Blot analysis of NKX3-1 expression in PC-12.)

Western Blot (WB) (NKX3-1 monoclonal antibody. Western Blot analysis of NKX3-1 expression in PC-12.)

Western Blot (WB)

(NKX3-1 monoclonal antibody. Western Blot analysis of NKX3-1 expression in Raw 264.7.)

Western Blot (WB) (NKX3-1 monoclonal antibody. Western Blot analysis of NKX3-1 expression in Raw 264.7.)

Western Blot (WB)

(NKX3-1 monoclonal antibody. Western Blot analysis of NKX3-1 expression in NIH/3T3.)

Western Blot (WB) (NKX3-1 monoclonal antibody. Western Blot analysis of NKX3-1 expression in NIH/3T3.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to NKX3-1 on NIH/3T3 cell. [antibody concentration 10ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to NKX3-1 on NIH/3T3 cell. [antibody concentration 10ug/ml])

Testing Data

(Detection limit for recombinant GST tagged NKX3-1 is ~0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged NKX3-1 is ~0.1ng/ml as a capture antibody.)
Product Categories/Family for anti-NKX3-1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
28.7kDa (257aa)
NCBI Official Full Name
homeobox protein Nkx-3.1 isoform 1
NCBI Official Synonym Full Names
NK3 homeobox 1
NCBI Official Symbol
NKX3-1
NCBI Official Synonym Symbols
NKX3; BAPX2; NKX3A; NKX3.1
NCBI Protein Information
homeobox protein Nkx-3.1
UniProt Protein Name
Homeobox protein Nkx-3.1
Protein Family
UniProt Gene Name
NKX3-1
UniProt Synonym Gene Names
NKX3.1; NKX3A
UniProt Entry Name
NKX31_HUMAN

NCBI Description

This gene encodes a homeobox-containing transcription factor. This transcription factor functions as a negative regulator of epithelial cell growth in prostate tissue. Aberrant expression of this gene is associated with prostate tumor progression. Alternate splicing results in multiple transcript variants of this gene. [provided by RefSeq, Jan 2012]

Uniprot Description

NKX3-1: Transcription factor, which binds preferentially the consensus sequence 5'-TAAGT[AG]-3' and can behave as a transcriptional repressor. Play an important role in normal prostate development, regulating proliferation of glandular epithelium and in the formation of ducts in prostate. Act as a tumor suppressor controlling prostate carcinogenesis, as shown by the ability to inhibit proliferation and invasion activities of PC-3 prostate cancer cells. Interacts with serum response factor (SRF). Interacts with SPDEF. Interacts with WDR77. Interacts with TOPORS which polyubiquitinates NKX3-1 and induces its proteasomal degradation. By androgens and, in the LNCAP cell line, by estrogens. Androgenic control may be lost in prostate cancer cells during tumor progression from an androgen-dependent to an androgen- independent phase. Highly expressed in the prostate and, at a lower level, in the testis. Belongs to the NK-3 homeobox family. 5 isoforms of the human protein are produced by alternative splicing.

Protein type: DNA-binding; Tumor suppressor; Transcription factor

Chromosomal Location of Human Ortholog: 8p21.2

Cellular Component: intracellular; nucleus

Molecular Function: androgen receptor activity; protein binding; estrogen receptor activity; protein self-association; sequence-specific DNA binding; histone deacetylase binding; estrogen receptor binding; caspase activator activity; transcription factor binding; protein kinase activator activity; transcription factor activity

Biological Process: transcription from RNA polymerase II promoter; salivary gland development; positive regulation of transcription, DNA-dependent; multicellular organismal development; heart development; negative regulation of insulin-like growth factor receptor signaling pathway; positive regulation of caspase activity; positive regulation of mitotic cell cycle; negative regulation of cell proliferation; regulation of transcription, DNA-dependent; positive regulation of cell proliferation; protein kinase B signaling cascade; negative regulation of mitotic cell cycle; negative regulation of epithelial cell proliferation; caspase activation; somitogenesis; pharyngeal system development; male gonad development; response to testosterone stimulus; positive regulation of phosphoinositide 3-kinase cascade; branching morphogenesis of a tube; positive regulation of protein kinase activity; positive regulation of cell division; androgen receptor signaling pathway; positive regulation of transcription from RNA polymerase II promoter; steroid hormone mediated signaling; positive regulation of protein amino acid phosphorylation; negative regulation of transcription, DNA-dependent; metanephros development

Research Articles on NKX3-1

Similar Products

Product Notes

The NKX3-1 nkx3-1 (Catalog #AAA6143197) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The NKX3-1 (Homeobox Protein Nkx-3.1, Homeobox Protein NK-3 Homolog A, NKX3.1, NKX3A) (Biotin) reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's NKX3-1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunofluorescence (IF), Western Blot (WB). IF: 10ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the NKX3-1 nkx3-1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "NKX3-1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.