Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37kD).)

Mouse anti-Human TPRX1 Monoclonal Antibody | anti-TPRX1 antibody

TPRX1 (FLJ40321, Tetra-peptide Repeat Homeobox Protein 1) (FITC)

Gene Names
TPRX1; TPRX
Reactivity
Human
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
TPRX1; Monoclonal Antibody; TPRX1 (FLJ40321; Tetra-peptide Repeat Homeobox Protein 1) (FITC); anti-TPRX1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2B4
Specificity
Recognizes human TPRX1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Applicable Applications for anti-TPRX1 antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes
IHC-P: 0.8ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant protein corresponding to aa313-412 from human TPRX1 (NP_940881) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
GSGSVPAPIPGPGSLPAPAPLWPQSPDASDFLPDTQLFPHFTELLLPLDPLEGSSVSTMTSQYQEGDDSMGKKHSGSQPQEEGGSVNENHSGPRLLLDL*
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37kD).)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to TPRX1 on formalin-fixed paraffin-embedded human liver. [antibody concentration 0.8ug/ml])

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to TPRX1 on formalin-fixed paraffin-embedded human liver. [antibody concentration 0.8ug/ml])
Product Categories/Family for anti-TPRX1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
40kDa
NCBI Official Full Name
tetra-peptide repeat homeobox protein 1
NCBI Official Synonym Full Names
tetrapeptide repeat homeobox 1
NCBI Official Symbol
TPRX1
NCBI Official Synonym Symbols
TPRX
NCBI Protein Information
tetra-peptide repeat homeobox protein 1
UniProt Protein Name
Tetra-peptide repeat homeobox protein 1
UniProt Gene Name
TPRX1
UniProt Entry Name
TPRX1_HUMAN

NCBI Description

Homeobox genes encode DNA-binding proteins, many of which are thought to be involved in early embryonic development. Homeobox genes encode a DNA-binding domain of 60 to 63 amino acids referred to as the homeodomain. This gene is a member of the TPRX homeobox gene family. [provided by RefSeq, Jul 2008]

Uniprot Description

TPRX1: 2 isoforms of the human protein are produced by alternative splicing.

Protein type: DNA-binding

Chromosomal Location of Human Ortholog: 19q13.33

Cellular Component: nucleus

Molecular Function: DNA binding

Similar Products

Product Notes

The TPRX1 tprx1 (Catalog #AAA6150193) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The TPRX1 (FLJ40321, Tetra-peptide Repeat Homeobox Protein 1) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TPRX1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB). IHC-P: 0.8ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the TPRX1 tprx1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "TPRX1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.