<
Western Blot (WB)
(Western blot analysis of extracts of various cell lines, using TOM20 antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.)
Rabbit TOM20 Monoclonal Antibody | anti-TOM20 antibody
TOM20 Rabbit mAb
Reactivity
Human, Mouse, Rat
Applications
Western Blot, Immunohistochemistry, Immunofluorescence, Immunoprecipitation
Purity
Affinity purification
Synonyms
TOM20; Monoclonal Antibody; TOM20 Rabbit mAb; TOMM20; MAS20; MOM19; translocase of outer mitochondrial membrane 20; anti-TOM20 antibody
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Monoclonal
Isotype
IgG
Purity/Purification
Affinity purification
Sequence
YCIYFDRKRRSDPNFKNRLRERRKKQKLAKERAGLSKLPDLKDAEAVQKFFLEEIQLGEELLAQGEYEKGVDHLTNAIAVCGQPQQLLQVLQQTLPPPVFQMLLTKLPTISQRIVSAQSLAEDDVE
Applicable Applications for anti-TOM20 antibody
Western Blot (WB), Immunohistochemistry (IHC), Immunofluorescence (IF), Immunoprecipitation (IP)
Application Notes
WB: 1:1000 - 1:50000; IHC: 1:50 - 1:200; IF: 1:50 - 1:200; IP: 1:20 - 1:50
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 20-145 of human TOM20 (NP_055580.1).
Storage Buffer
PBS with 0.09% sodium azide, 50% glycerol, pH7.3.
Positive Samples
THP-1, HeLa, MCF7, Mouse brain
Cellular Location
Mitochondrion outer membrane, Single-pass membrane protein
Preparation and Storage
Store at -20 degree C. Avoid freeze / thaw cycles.
Western Blot (WB)
(Western blot analysis of extracts of various cell lines, using TOM20 antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.)
Western Blot (WB)
(Western blot analysis of extracts of various cell lines, using TOM20 antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.)
Western Blot (WB)
(Western blot analysis of extracts of THP-1 cells, using TOM20 antibody at 1:10000-1:1280000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 5s.)
Western Blot (WB)
(Western blot analysis of extracts of THP-1 cells, using TOM20 antibody at 1:10000-1:1280000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 5s.)
Immunohistochemistry (IHC)
(Immunohistochemistry of paraffin-embedded Rat kidney using TOM20 antibody at dilution of 1:200 (40x lens).)
Immunohistochemistry (IHC)
(Immunohistochemistry of paraffin-embedded Rat kidney using TOM20 antibody at dilution of 1:200 (40x lens).)
Immunohistochemistry (IHC)
(Immunohistochemistry of paraffin-embedded Human colon carcinoma using TOM20 antibody at dilution of 1:200 (40x lens).)
Immunohistochemistry (IHC)
(Immunohistochemistry of paraffin-embedded Human colon carcinoma using TOM20 antibody at dilution of 1:200 (40x lens).)
Immunohistochemistry (IHC)
(Immunohistochemistry of paraffin-embedded Mouse heart using TOM20 antibody at dilution of 1:200 (40x lens).)
Immunohistochemistry (IHC)
(Immunohistochemistry of paraffin-embedded Mouse heart using TOM20 antibody at dilution of 1:200 (40x lens).)
Immunofluorescence (IF)
(Immunofluorescence analysis of C6 cells using TOM20 antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)
Immunofluorescence (IF)
(Immunofluorescence analysis of C6 cells using TOM20 antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)
Immunofluorescence (IF)
(Immunofluorescence analysis of HeLa cells using TOM20 antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)
Immunofluorescence (IF)
(Immunofluorescence analysis of HeLa cells using TOM20 antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)
Immunofluorescence (IF)
(Immunofluorescence analysis of NIH/3T3 cells using TOM20 antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)
Immunofluorescence (IF)
(Immunofluorescence analysis of NIH/3T3 cells using TOM20 antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)
Immunoprecipitation (IP)
(Immunoprecipitation analysis of 200ug extracts of HeLa cells using 3ug TOM20 antibody. Western blot was performed from the immunoprecipitate using TOM20 antibody at a dilition of 1:1000.)
Immunoprecipitation (IP)
(Immunoprecipitation analysis of 200ug extracts of HeLa cells using 3ug TOM20 antibody. Western blot was performed from the immunoprecipitate using TOM20 antibody at a dilition of 1:1000.)
Related Product Information for anti-TOM20 antibody
TOMM20 (Translocase Of Outer Mitochondrial Membrane 20) is a Protein Coding gene. Diseases associated with TOMM20 include Perry Syndrome. Among its related pathways are Neuroscience and Glucose / Energy Metabolism. Gene Ontology (GO) annotations related to this gene include unfolded protein binding and P-P-bond-hydrolysis-driven protein transmembrane transporter activity. An important paralog of this gene is TOMM20L
NCBI and Uniprot Product Information
UniProt Accession #
Molecular Weight
Calculated MW: 16kDa; Observed MW: 16kDa
Protein Family
Similar Products
Product Notes
The TOM20 (Catalog #AAA9141647) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TOM20 Rabbit mAb reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's TOM20 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunohistochemistry (IHC), Immunofluorescence (IF), Immunoprecipitation (IP). WB: 1:1000 - 1:50000; IHC: 1:50 - 1:200; IF: 1:50 - 1:200; IP: 1:20 - 1:50. Researchers should empirically determine the suitability of the TOM20 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: YCIYFDRKRR SDPNFKNRLR ERRKKQKLAK ERAGLSKLPD LKDAEAVQKF FLEEIQLGEE LLAQGEYEKG VDHLTNAIAV CGQPQQLLQV LQQTLPPPVF QMLLTKLPTI SQRIVSAQSL AEDDVE. It is sometimes possible for the material contained within the vial of "TOM20, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
