Western Blot (WB)
(Western Blot detection against Immunogen (63.95kD).)
Mouse anti-Human TOB2 Monoclonal Antibody | anti-TOB2 antibody
TOB2 (Protein Tob2, Transducer of erbB-2 2, Protein Tob4, KIAA1663, TOB4, TOBL, TROB2) (HRP)
Gene Names
TOB2; TOB4; TOBL; APRO5; TROB2
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
TOB2; Monoclonal Antibody; TOB2 (Protein Tob2; Transducer of erbB-2 2; Protein Tob4; KIAA1663; TOB4; TOBL; TROB2) (HRP); anti-TOB2 antibody
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
2F2-1A7
Specificity
Recognizes human TOB2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Applicable Applications for anti-TOB2 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to aa1-344 from human TOB2 (AAH38957) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MQLEIKVALNFIISYLYNKLPRRRADLFGEELERLLKKKYEGHWYPEKPLKGSGFRCVHIGEMVDPVVELAAKRSGLAVEDVRANVPEELSVWIDPFEVSYQIGEKGAVKVLYLDDSEGCGAPELDKEIKSSFNPDAQVFVPIGSQDSSLSNSPSPSFGQSPSPTFIPRSAQPITFTTASFAATKFGSTKMKKGGGAASGGGVASSGAGGQQPPQQPRMARSPTNSLLKHKSLSLSMHSLNFITANPAPQSQLSPNAKEFVYNGGGSPSLFFDAADGQGSGTPGPFGGSGAGTCNSSSFDMAQVFGGGANSLFLEKTPFVEGLSYNLNTMQYPSQQFQPVVLAN
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Western Blot (WB)
(Western Blot detection against Immunogen (63.95kD).)
Western Blot (WB)
(Western Blot detection against Immunogen (63.95kD).)
Western Blot (WB)
(Western Blot analysis of TOB2 expression in transfected 293T cell line by TOB2 monoclonal antibody Lane 1: TOB2 transfected lysate (36.6kD). Lane 2: Non-transfected lysate.)
Western Blot (WB)
(Western Blot analysis of TOB2 expression in transfected 293T cell line by TOB2 monoclonal antibody Lane 1: TOB2 transfected lysate (36.6kD). Lane 2: Non-transfected lysate.)
Testing Data
(Detection limit for recombinant GST tagged TOB2 is 0.3ng/ml as a capture antibody.)
Testing Data
(Detection limit for recombinant GST tagged TOB2 is 0.3ng/ml as a capture antibody.)
Product Categories/Family for anti-TOB2 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
Molecular Weight
27,192 Da
NCBI Official Full Name
Homo sapiens transducer of ERBB2, 2, mRNA
NCBI Official Synonym Full Names
transducer of ERBB2, 2
NCBI Official Symbol
TOB2
NCBI Official Synonym Symbols
TOB4; TOBL; APRO5; TROB2
NCBI Protein Information
protein Tob2
Protein Family
NCBI Description
TOB2 belongs to the TOB (see TOB1; MIM 605523)/BTG1 (MIM 109580) family of antiproliferative proteins, which are involved in the regulation of cell cycle progression.[supplied by OMIM, Apr 2004]
Research Articles on TOB2
Similar Products
Product Notes
The TOB2 (Catalog #AAA6155475) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The TOB2 (Protein Tob2, Transducer of erbB-2 2, Protein Tob4, KIAA1663, TOB4, TOBL, TROB2) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TOB2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the TOB2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "TOB2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
