Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.67kD).)

Mouse anti-Human TMPRSS3 Monoclonal Antibody | anti-TMPRSS3 antibody

TMPRSS3 (Transmembrane Protease Serine 3, ECHOS1, Serine Protease TADG-12, Tumor-associated Differentially-expressed Gene 12 Protein, TADG12, UNQ323/PRO382, DFNB8, DFNB10) APC

Gene Names
TMPRSS3; DFNB8; DFNB10; ECHOS1; TADG12
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
TMPRSS3; Monoclonal Antibody; TMPRSS3 (Transmembrane Protease Serine 3; ECHOS1; Serine Protease TADG-12; Tumor-associated Differentially-expressed Gene 12 Protein; TADG12; UNQ323/PRO382; DFNB8; DFNB10) APC; EC=3.4.21.-; anti-TMPRSS3 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2E1
Specificity
Recognizes human TMPRSS3.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-TMPRSS3 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa119-215 from human TMPRSS3 (NP_076927) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
VFTAASWKTMCSDDWKGHYANVACAQLGFPSYVSSDNLRVSSLEGQFREEFVSIDHLLPDDKVTALHHSVYVREGCASGHVVTLQCTACGHRRGYS
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.67kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.67kD).)
Product Categories/Family for anti-TMPRSS3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
50kDa
NCBI Official Full Name
transmembrane protease serine 3 isoform 1
NCBI Official Synonym Full Names
transmembrane serine protease 3
NCBI Official Symbol
TMPRSS3
NCBI Official Synonym Symbols
DFNB8; DFNB10; ECHOS1; TADG12
NCBI Protein Information
transmembrane protease serine 3
UniProt Protein Name
Transmembrane protease serine 3
UniProt Gene Name
TMPRSS3
UniProt Synonym Gene Names
ECHOS1; TADG12
UniProt Entry Name
TMPS3_HUMAN

NCBI Description

This gene encodes a protein that belongs to the serine protease family. The encoded protein contains a serine protease domain, a transmembrane domain, an LDL receptor-like domain, and a scavenger receptor cysteine-rich domain. Serine proteases are known to be involved in a variety of biological processes, whose malfunction often leads to human diseases and disorders. This gene was identified by its association with both congenital and childhood onset autosomal recessive deafness. This gene is expressed in fetal cochlea and many other tissues, and is thought to be involved in the development and maintenance of the inner ear or the contents of the perilymph and endolymph. This gene was also identified as a tumor-associated gene that is overexpressed in ovarian tumors. Alternatively spliced transcript variants have been described. [provided by RefSeq, Jan 2012]

Uniprot Description

TMPRSS3: Probable serine protease that play a role in hearing. Acts as a permissive factor for cochlear hair cells survival and activation at the onset of hearing and is required for saccular hair cell survival. Activates ENaC (in vitro). Defects in TMPRSS3 are the cause of deafness autosomal recessive type 8 (DFNB8). DFNA8 is a form of sensorineural hearing loss. Sensorineural deafness results from damage to the neural receptors of the inner ear, the nerve pathways to the brain, or the area of the brain that receives sound information. Defects in TMPRSS3 are the cause of deafness autosomal recessive type 10 (DFNB10). Belongs to the peptidase S1 family. 5 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 3.4.21.-; Membrane protein, integral; Endoplasmic reticulum; Protease

Chromosomal Location of Human Ortholog: 21q22.3

Cellular Component: endoplasmic reticulum membrane; cell soma; endoplasmic reticulum; integral to membrane

Molecular Function: sodium channel regulator activity; serine-type endopeptidase activity; scavenger receptor activity

Biological Process: receptor-mediated endocytosis; cellular sodium ion homeostasis; sensory perception of sound; proteolysis

Disease: Deafness, Autosomal Recessive 8

Research Articles on TMPRSS3

Similar Products

Product Notes

The TMPRSS3 tmprss3 (Catalog #AAA6139539) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The TMPRSS3 (Transmembrane Protease Serine 3, ECHOS1, Serine Protease TADG-12, Tumor-associated Differentially-expressed Gene 12 Protein, TADG12, UNQ323/PRO382, DFNB8, DFNB10) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TMPRSS3 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the TMPRSS3 tmprss3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "TMPRSS3, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.